DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and FOXI2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_997309.2 Gene:FOXI2 / 399823 HGNCID:32448 Length:318 Species:Homo sapiens


Alignment Length:352 Identity:94/352 - (26%)
Similarity:136/352 - (38%) Gaps:116/352 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 SVSPP--------PPNMTPTSQVHNGSLGGGGGGGGGSGGGGGGG----GANLRSPNSYASYDNE 632
            |.:||        ||...|                |..|..|||.    .|...||.||||... 
Human    11 SSAPPGQAQATAHPPGYEP----------------GDLGAVGGGPLLWVNAPALSPKSYASGPG- 58

  Fly   633 DSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGS-----NTPQKQKHPNNVPYD 692
                            ..|.|:....||.|...|   ..|..||:     :...:|:....|   
Human    59 ----------------PAPPYAAPSYGAPGPLLG---APGGLAGADLAWLSLSGQQELLRLV--- 101

  Fly   693 PLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKS 757
                   :||||:|:||.|||:.:..:.|.:.:||.::..:||::|.:..||:||:|||||||..
Human   102 -------RPPYSYSALIAMAIQSAPLRKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDC 159

  Fly   758 FVKVEK-APNMGKGSLWRVEP--------------QQRQNLIQALNRS-----------PFFPNS 796
            |.||.: ..:.|||:.|.::|              ::|:....|..||           ...|.|
Human   160 FKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPS 224

  Fly   797 A--VD-KISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGGAGV-PAAAAVALS----TPTKSNG 853
            |  :| :.|||..:|...:.:       ||..|:...:|||.|. |...|...|    .||    
Human   225 AACLDLQASPSPSAPEAATCF-------SGFASAMSALAGGLGTFPGGLAGDFSFGRRPPT---- 278

  Fly   854 LALANGASQATNAARPHSPNGGGSGSH 880
                    .||:|.:..:|:.|.:..|
Human   279 --------VATHAPQTLNPSPGFAPGH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 36/99 (36%)
FOXI2NP_997309.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 6/34 (18%)
Forkhead 102..188 CDD:278670 35/85 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.