DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxi4.2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_989265.1 Gene:foxi4.2 / 394878 XenbaseID:XB-GENE-487658 Length:363 Species:Xenopus tropicalis


Alignment Length:323 Identity:85/323 - (26%)
Similarity:135/323 - (41%) Gaps:77/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 LHTST--PQYSVSK--NGANGY----GNGNSNV-NGSGAGS-------NTPQKQKHPNNVPY--- 691
            ||.|.  |.:::.:  :.||.|    |:|.:|. |.|.:.:       ..||:|..||:..:   
 Frog    43 LHPSQRGPNFAIGEYTSPANPYLWLGGHGVNNAPNYSPSPAPYMPPSFGAPQRQFLPNSPAFGGT 107

  Fly   692 ----------DPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKN 746
                      :.|:.. .:||||:|:||.|||:.::::.|.:.:||.::.::||::|.:..||:|
 Frog   108 ELSWMSAASQEELLKM-VRPPYSYSALIAMAIQHASDRRLTLSQIYQYVAENFPFYKKSKAGWQN 171

  Fly   747 SVRHNLSLNKSFVKVEKAPN-MGKGSLWRVEPQQRQNLIQALNRSPFFPNSAVD----------- 799
            |:|||||||..|.||.:..| .|||:.|.::|...:.......|....|.|..:           
 Frog   172 SIRHNLSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRKPKSDANSAKIAKIGEDH 236

  Fly   800 -----KISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAA-------------AAVALS 846
                 |.||.:.:||...     :...:|...|..|       ||.             .||..:
 Frog   237 LNPKGKESPPMITPSSPE-----EPSPTGHSKSPSP-------PAVTYTPCLTNFIGSMTAVDAA 289

  Fly   847 TPTKSNGLALANGASQATNAARPHSPNGGG---SGSHARFDPYLFPNLSKAFRNIREDTVGQP 906
            |..:...|.|.|..||...::.....:|..   |..|.  |..||.|.|..:.:.......||
 Frog   290 TANRQGPLGLLNELSQRNISSLSSFISGSAVDQSAEHP--DTSLFYNRSPYYSSFPTTAQKQP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 36/85 (42%)
foxi4.2NP_989265.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Forkhead 125..210 CDD:306709 36/84 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..269 11/70 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..363 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.