DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxl1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:400 Identity:93/400 - (23%)
Similarity:144/400 - (36%) Gaps:112/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   644 SRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQ------KQKHPNNVPYDPLVHTNNKPP 702
            |..|:..||..|:.:.....|:....|.|...|...|.      :|:.|            .|||
Zfish     2 SLYHSPVPQSGVAASALGLSGSSLIYVYGGEVGGIIPALGFASGRQEPP------------QKPP 54

  Fly   703 YSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNM 767
            ||:.:||.|||:.:.:|...:..||.:|:..|||:.....||:||:|||||||..|:||.:....
Zfish    55 YSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPREKGR 119

  Fly   768 -GKGSLWRVEP-------------QQRQNLIQ------------ALNRSPFFPNSAVDKISPSLK 806
             ||||.|.::.             ::|:...|            .:........:..:|:||..:
Zfish   120 PGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTRVTSFKLHQGAQSEKVSPLKQ 184

  Fly   807 SPSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAAA-----------VAL---STPTKSNGLALA 857
            :|.......|.|         .||......|.:.:|           |:|   :||.:|      
Zfish   185 NPGRDIKEKSND---------TQPQNEEENVASESAKDWCLASSTTIVSLPRCTTPERS------ 234

  Fly   858 NGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQPMLQDALDDELSGDYHN 922
              ::.:|.|...|:|.  .|.|..|..             ::.|| |:....||...|       
Zfish   235 --STVSTVAVNTHTPL--SSASETRVP-------------VKSDT-GRAQSGDAKSKE------- 274

  Fly   923 NNNNNSGSKYNYMGANGSGGAGSGGVGSNANGASDGINFARLARDCGADSIDDVHAAAAMLYLKH 987
            :|...:..|           |....:.|..:...:  .|.|.....|..|:|....|.|...:.|
Zfish   275 SNPRKTTDK-----------AKEFSIDSILSKKEN--QFQRRCAAAGGASVDSRGYALASSLIAH 326

  Fly   988 G-PKIYSEPF 996
            . |::|...|
Zfish   327 AHPQLYPRGF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 37/98 (38%)
foxl1NP_957278.1 FH 52..140 CDD:214627 36/87 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.