DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxi2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_944598.2 Gene:foxi2 / 387256 ZFINID:ZDB-GENE-031126-2 Length:383 Species:Danio rerio


Alignment Length:336 Identity:88/336 - (26%)
Similarity:139/336 - (41%) Gaps:92/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 GYGNG-----NSNVNGSGAGSNTPQKQKHPNNVP-YDPLVHTNN--------------------- 699
            |||.|     |..:..:|.|.|:.....|.||.| :.|..:.:.                     
Zfish    55 GYGLGDYATPNPYLWLNGPGVNSSSSYIHGNNSPSFIPPAYGSQRQYLSNSSGFAGPDLGWLSIA 119

  Fly   700 ---------KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLN 755
                     :||||:|:||.|||:.::||.|.:.:||.::..:||::|.:..||:||:|||||||
Zfish   120 SQEELLKLVRPPYSYSALIAMAIQNAHEKKLTLSQIYQYVADNFPFYKKSKAGWQNSIRHNLSLN 184

  Fly   756 KSFVKVEK-APNMGKGSLWRVEP---------------QQRQNLIQAL--NRSP--------FFP 794
            ..|.||.: ..:.|||:.|.::|               ::|.:....:  |..|        ..|
Zfish   185 DCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSDSSTGVSSNTKPEDDRQLAGIKP 249

  Fly   795 NSAVDKISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAAAVALSTPTKSNG-LALAN 858
            ..:.....|:  ||...:|.||..|.....::|| |.........:|..:.||||..:| |.|.|
Zfish   250 TDSPHLTGPA--SPDADAATDSHKGASPAGLASA-PCFNNFFNSMSALGSSSTPTSRHGSLGLVN 311

  Fly   859 G-ASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQPMLQDALDDELSGDYHN 922
            . :|:..:|..|:         ||...|               :..|.|.|||::... .|.|:|
Zfish   312 ELSSRNISALSPY---------HASTGP---------------EAGGAPELQDSVHVN-RGMYYN 351

  Fly   923 NNNNNSGSKYN 933
            :......:::|
Zfish   352 SFTGGQSTQFN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/100 (38%)
foxi2NP_944598.2 Forkhead 129..215 CDD:278670 37/85 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.