DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxl3

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:113 Identity:39/113 - (34%)
Similarity:60/113 - (53%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 YGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIY 727
            |...|.:.:...|||:..:|:.              .:|.||:.:||.|||:.|....:.:..||
Mouse     9 YNCFNDDADDYPAGSSDEEKRL--------------TRPAYSYIALIAMAIQQSPAGRVTLSGIY 59

  Fly   728 AWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAP--NMGKGSLW 773
            .:|::.|||::.....|:||:|||||||..||||.:..  :.|||:.|
Mouse    60 DFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRTEGNDKGKGNYW 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 33/76 (43%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 33/76 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.