DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxl2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:261 Identity:82/261 - (31%)
Similarity:109/261 - (41%) Gaps:87/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   672 GSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPY 736
            |.|.|: .|:|.        ||.    .|||||:.:||.|||..|.||.|.:..||.:|:..||:
  Rat    35 GKGGGT-APEKP--------DPA----QKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPF 86

  Fly   737 FKTAPNGWKNSVRHNLSLNKSFVKVEKAPNMG----KGSLWRVEP-----------QQRQNLIQA 786
            ::....||:||:|||||||:.|:||   |..|    ||:.|.::|           ::|:.:   
  Rat    87 YEKNKKGWQNSIRHNLSLNECFIKV---PREGGGERKGNYWTLDPACEDMFEKGNYRRRRRM--- 145

  Fly   787 LNRSPFFPNSAVDKISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAAA--VALSTPT 849
              :.||.|       .|:...|..|     |.|.|.|        |||.|||.|.|  .....|.
  Rat   146 --KRPFRP-------PPAHFQPGKG-----LFGSGGG--------AGGCGVPGAGADGYGYLAPP 188

  Fly   850 K--SNGL----------------------ALANGASQATNAARPHSPNG-----GGSGSHARFDP 885
            |  .:|.                      |.|..|:.|..||.|.||..     |.:|..|.:.|
  Rat   189 KYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGP 253

  Fly   886 Y 886
            |
  Rat   254 Y 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 40/99 (40%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.