DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxi1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:362 Identity:92/362 - (25%)
Similarity:142/362 - (39%) Gaps:104/362 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 PNSYASYDNEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPN 687
            |:||...:.........|.::|...||||..|..        ||.|.:. ||.|||..|....|.
Zfish    63 PSSYGLGEYSSPSTNPYLWMNSPGITSTPYLSSP--------NGGSYIQ-SGFGSNQRQFLPPPT 118

  Fly   688 ----------NVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPN 742
                      ::.....:....:||||:|:||.|||:.:.:|.|.:.:||.::..:||::|.:..
Zfish   119 GFGSADLGWLSISSQQELFKMVRPPYSYSALIAMAIQNAQDKKLTLSQIYQYVADNFPFYKKSKA 183

  Fly   743 GWKNSVRHNLSLNKSFVKVEK-APNMGKGSLWRVEPQQRQNLIQALNRSPFFPNS--------AV 798
            ||:||:|||||||..|.||.: ..:.|||:.|.::|          |....|.|.        ..
Zfish   184 GWQNSIRHNLSLNDCFKKVARDEDDPGKGNYWTLDP----------NCEKMFDNGNFRRKRKRRA 238

  Fly   799 DKISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGGA-------GVPAAAAVALSTPTKSNGLAL 856
            |..:.|:||.......|:     |..:|::||....:       ..|:.:|.  .:|..||.:..
Zfish   239 DGNAMSVKSEDALKLADT-----SSLMSASQPSLQNSPTSSDPKSSPSPSAE--HSPCFSNFIGN 296

  Fly   857 ANGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQPMLQDALDDELSG--- 918
            .| :..:.||.|...    ||.:|                           |.|.....:||   
Zfish   297 MN-SIMSGNAVRSRD----GSSAH---------------------------LGDFTQHGMSGHEI 329

  Fly   919 --------------DYHNNNNNNSG---SKYNYMGAN 938
                          :|::.::||||   |..|:...|
Zfish   330 SPPSEPGHLNTNRLNYYSASHNNSGLINSISNHFSVN 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 36/85 (42%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 38/95 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.