DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and slp1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:273 Identity:80/273 - (29%)
Similarity:121/273 - (44%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 YASYDNEDSLKE-FDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNV------------NGSGAGS 677
            |::.|.|.|..| ||    |...||||..|.::: .:...|...:|            :......
  Fly    45 YSNSDGELSASEDFD----SPSRTSTPMSSAAES-LSSQNNDKLDVEFDDELEDQLDEDQESEDG 104

  Fly   678 NTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPN 742
            |..:|||....       ....|||||:::||.|||:.|.|:.|.:..||.:::..|||||....
  Fly   105 NPSKKQKMTAG-------SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKR 162

  Fly   743 GWKNSVRHNLSLNKSFVKVEKA-PNMGKGSLWRVEPQQRQNLI-----QALNRSPFFPNSAVDKI 801
            ||:||:||||||||.|.|:.:: .:.|||:.|.::|...:..|     :...::|....:.:...
  Fly   163 GWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAY 227

  Fly   802 SPSLKSP-SGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAAAVALSTPTKSNGLALA-------- 857
            ..::.|| ...|.|        |:.:|:.   |...||.|||.|.:...:.|..|..        
  Fly   228 RQAIFSPMMAASPY--------GAPASSY---GYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQY 281

  Fly   858 NGASQATNAARPH 870
            ..|.||.:...||
  Fly   282 QQAPQAHHHQAPH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 40/90 (44%)
slp1NP_476730.1 FH 120..205 CDD:214627 39/84 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.