DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and fd19B

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:179 Identity:60/179 - (33%)
Similarity:91/179 - (50%) Gaps:22/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 SVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPL-VHTNNKPPYSFSSLIFMAIEGSN 717
            ||.|...:.....||..:.|...|::       :|...|.: ..:|.||.:::|:||.|||..|:
  Fly    18 SVDKKEESPISKHNSGSSFSSCSSSS-------SNSSSDSMAAKSNAKPAFTYSALIVMAIWSSS 75

  Fly   718 EKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKA-PNMGKGSLWRVEPQQRQ 781
            ||.|.:..|..||..:|||::|..:.|:||:|||||||..||:|.:| .:.|:|..|.::|....
  Fly    76 EKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAED 140

  Fly   782 NLI----QALNRSPFFPNS-AVDKIS--PSLKSPSGGSAYDSLDGGGSG 823
            ..|    ..|.||.:..|: |..|::  |..:.|..|      .|.|:|
  Fly   141 LSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYG------HGHGNG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/89 (43%)
fd19BNP_608369.1 FH 58..135 CDD:238016 36/76 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.