DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxj3

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:559 Identity:130/559 - (23%)
Similarity:204/559 - (36%) Gaps:185/559 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 EDSLKEFDLVVSSRLHTSTPQYSVSKNGA--NGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPL 694
            |.||...|.     |...|.:.::.|:.|  |.:|.|.|..|.. ...||...|:....      
  Rat    21 ESSLTSMDW-----LPQLTMRAAIQKSDATQNAHGTGISKKNAL-LDPNTTLDQEEVQQ------ 73

  Fly   695 VHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFV 759
             |.:.|||||::|||..||..|.:|.:.:.|||.||..:|||::.|.:|||||:||||||||.|:
  Rat    74 -HKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFL 137

  Fly   760 KVEKA-PNMGKGSLWRVEPQQRQNLIQALNRSPFFPNSAVDKISPSLKSPSGGSAYDSLDGGGSG 823
            ||.:: .:.||||.|.::...:::.:      |..|.    |.:.|::..|...:.|| |..|..
  Rat   138 KVPRSKDDPGKGSYWAIDTNPKEDTL------PTRPK----KRARSVERASTPYSIDS-DSLGME 191

  Fly   824 SVSSAQPVAGGAGVPAAAAVALSTPTKSNGLALANGASQATNAARPHSPNGGGSGSHARFDPYLF 888
            .:.|..         |:..:|::|               .||....::.:..||.|         
  Rat   192 CIISGS---------ASPTLAINT---------------VTNKVTLYNTDQDGSDS--------- 223

  Fly   889 PNLSKAFRNIREDTVGQPMLQDALDDELSGDYHNNNNNNSGSKYNYMGANGSGGAGSGGVGSNAN 953
            |..|               |.::|.|:   ...:.|.|:.||.::|.           .|.::..
  Rat   224 PRSS---------------LNNSLSDQ---SLASVNLNSVGSVHSYT-----------PVTNHPE 259

  Fly   954 GASDGI----------------------NFARLARDCGADSIDDVHAAAAMLYLKHGPKIYSEPF 996
            ..|..:                      ||            :|:.|:...||    ..::.:..
  Rat   260 PVSQSLTPQQQPQYNLPERDKQLLFTEYNF------------EDLSASFRSLY----KSVFEQSL 308

  Fly   997 -QNGSGPVITSSPSEDHTYSAGGNSNADSGSSTPLTNGNALASVAQAVAQGQNNQGGAGSDSNCA 1060
             |.|...:.:.|..:.||..:..:|.:.:.:|.|.:|.::|          .||..|        
  Rat   309 SQQGLMSIPSESSQQSHTSCSYQHSPSSTVTSHPHSNQSSL----------PNNHSG-------- 355

  Fly  1061 SSDAAYDSSEENHNITPEEMADRQRHRDGVDALLSLSGSSIVECGSVATTHYHSNGSSGS---SH 1122
                                             ||.:||:.|...|::....|:..|..:   .|
  Rat   356 ---------------------------------LSATGSNSVAQVSLSHPQMHTQPSPHTPHRPH 387

  Fly  1123 GSP-HKRASSHSLEEEHLQQHREQQLQQQQQQQQHHHQQ 1160
            |.| |.:...|  ...|.|||.:.|....|....|.|.|
  Rat   388 GLPQHPQRPQH--PASHPQQHSQLQPPHSQHPPPHQHIQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 42/85 (49%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 92/387 (24%)
FH_FOXJ3 77..155 CDD:410826 42/77 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.