DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxs1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:222 Identity:57/222 - (25%)
Similarity:99/222 - (44%) Gaps:50/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 NKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKV-- 761
            :|||||:.:||.|||:.|..:...:..||.:|:..|.:::....||:||:|||||||:.||||  
  Rat    17 SKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPR 81

  Fly   762 -EKAPNMGKGSLWRVEP------------QQRQNL-------------------IQALNRSPFFP 794
             ::.|  ||||.|.::|            ::|:..                   ::|.:.....|
  Rat    82 DDRKP--GKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVKADHRPLRATSPDQGAP 144

  Fly   795 NSAVDKI---SPSLKSPSG-GSAYDSLDGGGSGSVSSAQP---------VAGGAGVPAAAAVALS 846
            |:...::   .|.:.:|.| |....||......:.|..:|         .:..:|.|...:.|.|
  Rat   145 NTTTGRLCPFPPEVPNPKGFGGLMGSLPANMCPTTSDTRPQLPTGPKDMCSAKSGGPRELSEATS 209

  Fly   847 TPTKSNGLALANGASQATNAARPHSPN 873
             |:.......::..|:|.:..:..:|:
  Rat   210 -PSPCPAFGFSSAFSEAESLGKAPTPS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/118 (32%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.