DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxe3

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_056573.1 Gene:Foxe3 / 30923 MGIID:1353569 Length:288 Species:Mus musculus


Alignment Length:264 Identity:77/264 - (29%)
Similarity:107/264 - (40%) Gaps:61/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 GAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFK 738
            |.|...|.....|......||  ...|||||:.:||.||:..:..:.|.:..||.:|.:.|.:::
Mouse    40 GGGDAEPTAVPGPGKRRRRPL--QRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYR 102

  Fly   739 TAPNGWKNSVRHNLSLNKSFVKVEKAP-NMGKGSLWRVEP------------QQRQNLIQA---- 786
            .:|..|:||:||||:||..||||.:.| |.|||:.|.::|            ::|:...:|    
Mouse   103 DSPRKWQNSIRHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAELPA 167

  Fly   787 -------LNRSPFFPNSAVDKISPSLKSPSGGSAYDSLDG---GGSGSVSSAQP--VAGGAGVPA 839
                   ...:||.|..|     |:...|:.....|||.|   ...|.|:...|  .|..|..|.
Mouse   168 PPPPPPPFPYAPFPPPPA-----PASAPPARLFRLDSLLGLQPEPPGPVAPEPPCCAAPDAAFPP 227

  Fly   840 AAAVALSTPTKSNG---------------LALANGASQATNAARPHSPNGGGSGSHARFDPYLFP 889
            .||.| |.|..|..               ||||..|...       .|.|.|. ::.| .|...|
Mouse   228 CAAAA-SPPLYSPASERLGLPAPLPAQPLLALAGSAGAL-------GPLGAGE-AYLR-QPGFAP 282

  Fly   890 NLSK 893
            .|.:
Mouse   283 GLER 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 36/97 (37%)
Foxe3NP_056573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 6/23 (26%)
FH 64..152 CDD:214627 35/87 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..189 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.