DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxd5

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:225 Identity:65/225 - (28%)
Similarity:96/225 - (42%) Gaps:46/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 DNEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPL 694
            |:.||.:|:.:         .....|..:|:...|...|:.    |.|....||.          
Zfish    28 DHSDSEREYFM---------RDPTEVDHSGSESSGESESDF----ASSTVAPKQS---------- 69

  Fly   695 VHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFV 759
              ::.|||||:.:||.|||..|..|.|.:..|..:|...|||:|.....|:||:|||||||..|:
Zfish    70 --SSVKPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFI 132

  Fly   760 KVEKAP-NMGKGSLWRVEPQQRQ-----NLIQALNR----SPFFPNSAVDKISPSLKSPSGGSAY 814
            |:.:.| |.|||:.|.::|....     :.::...|    .|.|...::....|:|...:.|..|
Zfish   133 KIPREPGNPGKGNYWSLDPASEDMFDNGSFLRRRKRFKRNQPEFTKDSLVLYHPTLSYRAYGRPY 197

  Fly   815 DSLDGGGSGSVSSAQ------PVAGGAGVP 838
            ..     ||:|.:..      ||..|..||
Zfish   198 CV-----SGAVPAQTNPVGYLPVPDGIMVP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/90 (42%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 38/85 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.