DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxn2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_006239798.1 Gene:Foxn2 / 301676 RGDID:1562291 Length:428 Species:Rattus norvegicus


Alignment Length:274 Identity:100/274 - (36%)
Similarity:135/274 - (49%) Gaps:63/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   667 NSNVNGSGAGSNTPQKQKHPNNVP-YDPLVHTN-------NKPPYSFSSLIFMAIEGSNEKALPV 723
            |..:.|.|....:|......:::| :.||...|       :|||||||.||:||||.|..|.|||
  Rat    71 NLRLGGEGLPMVSPLYDIEGDDMPSFGPLCCQNPEKKSATSKPPYSFSLLIYMAIEHSPNKCLPV 135

  Fly   724 KEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNM--GKGSLWRVEPQQRQNLIQA 786
            ||||:||:..||||.|||.||||||||||||||.|.|||::...  ||||||.|:|:.:.||:||
  Rat   136 KEIYSWILDRFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLVQA 200

  Fly   787 LNRSPF-FPNSAVDKISPS-LKSPSGGSAYDSLDGGGSGSVSS---------------AQPV--- 831
            |.:.|| .|.||  .:||. |.|....|...:|......:.::               .:|:   
  Rat   201 LKKQPFSSPQSA--SLSPHYLSSVLKQSQVQTLKESDIDAATAMILLNTSIEQEMLECEKPLPLK 263

  Fly   832 -------AGGAGVPAAAAVALS---TPTKS-----------NGLALANGASQATNAAR------- 868
                   :.|:...|.:||.|.   :|..|           :|:|....||:|:.::.       
  Rat   264 TSLQKKRSYGSAFSAPSAVQLQESHSPASSIDPKADHNYSASGVAAQRCASRASMSSLSSVDEVY 328

  Fly   869 ---PHSPNGGGSGS 879
               |.|.:||..||
  Rat   329 EFIPKSSHGGSDGS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 59/86 (69%)
Foxn2XP_006239798.1 FH_FOXN2 111..192 CDD:410832 56/80 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5299
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005460
OrthoInspector 1 1.000 - - otm45143
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.