DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxi2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:340 Identity:95/340 - (27%)
Similarity:133/340 - (39%) Gaps:63/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   577 LQLSVSP--PPPNMTPTSQVHNGSLGGGGGGGG-GSGGGGGGGGANLRSPNSYASYDNEDSLKEF 638
            :..|..|  |.|...|......|.|...|...| ||.....|....:..|.||...|.....:  
  Rat     1 MSFSTEPTAPAPAPAPAPAQAGGELDMAGFCDGLGSCSVPHGLTRAIAHPPSYGRADLGSGRR-- 63

  Fly   639 DLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGS---------GAG----SNTPQKQKHPNNVP 690
             |.|:|...:..| |:.....|..|......|:||         ||.    |.:.|::       
  Rat    64 -LWVNSTALSPAP-YTPGPGPAPTYAAAALAVSGSLLSPSGGLAGADLAWLSLSGQQE------- 119

  Fly   691 YDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLN 755
               |:.. .:||||:|:||.|||:.:..:.|.:.:||.::..:||::|.:..||:||:|||||||
  Rat   120 ---LLRL-VRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLN 180

  Fly   756 KSFVKVEKAPN-MGKGSLWRVEPQ-----QRQNLIQALNRSPFFPNSAVDKISPSLKSPSGGSAY 814
            ..|.||.:..| .|||:.|.::|.     ...|..:...|......:||    |....|...:..
  Rat   181 DCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRGETSEAAV----PGASRPERAALE 241

  Fly   815 DSLDGGGSGSVSSAQPVAGGAGVPAAAAVALSTPTKSNGLA-----LANGASQ--------ATNA 866
            .      ||.||.....:.....|.|||...|..|....||     |.:|..|        ..::
  Rat   242 P------SGLVSQDLQTSPSPTAPEAAACLSSFSTALGALAGGFSTLPDGLPQDFSLRRPPTESS 300

  Fly   867 ARPHSPN---GGGSG 878
            .||..||   |.|.|
  Rat   301 RRPQIPNTSPGFGPG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 37/90 (41%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.