DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxg1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_036692.1 Gene:Foxg1 / 24370 RGDID:2619 Length:480 Species:Rattus norvegicus


Alignment Length:567 Identity:132/567 - (23%)
Similarity:197/567 - (34%) Gaps:201/567 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 VPKTSSF---STVFEAVNYATSAASNSSSSSNSTPNSQAILHGQESPAVVTTTTLISAGTLPPGY 522
            :|| |||   |.|.|||......||:...:|:...:.....|....|              ||  
  Rat    13 IPK-SSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPP--------------PP-- 60

  Fly   523 SFVNQVASTPHVLSTPAHVASPETPPGAALLPGTYYATSTTSAGTTTTTLQARSLQLSVSP--PP 585
                  |..|    .|......:.||.|...|                  |||....:...  |.
  Rat    61 ------APQP----PPPPPQQQQQPPPAPQPP------------------QARGAPAADDDKGPQ 97

  Fly   586 PNMTPTSQVHNGSLGGGGGGGGGSGGGGGGGGANLRSPNSYASYDNEDSLKEFDLVVSSRLHTST 650
            |.:.|.|...:|:.....|..|..|||          |...|....::..|              
  Rat    98 PLLLPPSAALDGAKADALGAKGEPGGG----------PAELAPVGPDEKEK-------------- 138

  Fly   651 PQYSVSKNGANGYGNGNSNVNGSGAGSNTPQ--KQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAI 713
                       |.|.|.....|:|.|....:  |:....|..|:       |||:|:::||.|||
  Rat   139 -----------GAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYE-------KPPFSYNALIMMAI 185

  Fly   714 EGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEK-APNMGKGSLWRVEP 777
            ..|.||.|.:..||.:|:::|||::....||:||:||||||||.||||.: ..:.|||:.|.::|
  Rat   186 RQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDP 250

  Fly   778 --------------QQRQNLIQA-----------------LNR--SPFFPNSAVDKISP--SLKS 807
                          ::|....:|                 ::|  |.::|      :||  ||..
  Rat   251 SSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWP------MSPFLSLHH 309

  Fly   808 PSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAAAVALSTPTKSNGLALANGAS--QATNAARPH 870
            |...|   :|...|:.|...:.|      :|.::.:..::...::..:.|||.|  :..|...|:
  Rat   310 PRASS---TLSYNGTTSAYPSHP------MPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPY 365

  Fly   871 S-------------PNGGG---SGSHARFDP-----------YLFPNL-----------SKAFRN 897
            :             |.|..   ||::: .:|           |.||::           |.:.|.
  Rat   366 ATHHLTAAALAASVPCGLSVPCSGTYS-LNPCSVNLLAGQTSYFFPHVPHPSMTSQTSTSMSARA 429

  Fly   898 IREDTVGQ--------------PMLQDALDDELSGDYHNNNNNNSGS 930
            ....|..|              |.....|...|| ||..:.|..|.|
  Rat   430 ASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLS-DYFTHQNQGSSS 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 41/99 (41%)
Foxg1NP_036692.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..172 39/226 (17%)
FH_FOXG 172..250 CDD:410795 39/77 (51%)
COG5025 <175..>347 CDD:227358 53/186 (28%)
Required for interaction with TLE6. /evidence=ECO:0000250|UniProtKB:Q60987 240..335 21/109 (19%)
Interaction with KDM5B. /evidence=ECO:0000250 374..397 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..446 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.