DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxi3

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:461 Identity:107/461 - (23%)
Similarity:176/461 - (38%) Gaps:121/461 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 GYSFV-NQVASTPHVLST---PAHVASPETPPGAALLPGTYYATSTTSAGTTTTTLQARSLQLSV 581
            |.:|| :|.|:.|....|   |..::....||.||..|  |...:....|...:.    :..|..
Mouse     6 GDNFVYSQPAAAPGAPPTSRAPYGLSDYAAPPAAAANP--YLWLNGPGVGGPASA----ASYLGA 64

  Fly   582 SPPPPNMTPTSQVHNGSLGGGGGGGGGSGGGGGGGGANLRSPNSYASYDNEDSLKEFDLVVSSRL 646
            .||||...|                          |..|:.|.:..::                 
Mouse    65 PPPPPGAAP--------------------------GPFLQPPAAPGTF----------------- 86

  Fly   647 HTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFM 711
                      .....|:...:::...|.|||..|.:....:....:.|:.. .:||||:|:||.|
Mouse    87 ----------AGAQRGFAQPSASAPASPAGSAAPGELGWLSMASREDLMKM-VRPPYSYSALIAM 140

  Fly   712 AIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEK-APNMGKGSLWRV 775
            ||:.:.|:.|.:..||.::..:||:::.:..||:||:|||||||..|.||.: ..:.|||:.|.:
Mouse   141 AIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTL 205

  Fly   776 EPQQRQNLIQALNRSPFFPNSAVDK-------ISPSLKSPSGGSAYD----------SLDGGGSG 823
            :|          |....|.|....:       .|.:|..|||.|..:          .|:|....
Mouse   206 DP----------NCEKMFDNGNFRRKRRRRAEASSNLTVPSGTSKSEGQSSRLRVSGKLEGDSPS 260

  Fly   824 SV----SSAQPVAG---GAGVPAAAAVALSTPTKSNGLALANGASQATNAARPHSPNGGGSGSH- 880
            |:    .|.:|..|   .|..|.|:.:. |||..:..|:..|..:..::::..:.....||..| 
Mouse   261 SILRPSQSPEPPEGTKSTASSPGASTLT-STPCLNTFLSTFNTLNVNSSSSMGNQRTLPGSRRHL 324

  Fly   881 --ARFDPYLFPNLS---KAFRNIREDTVGQPMLQDALDDELSGDYHNNNNNNSGSK--------Y 932
              .:.....|||.|   .:..:::..|||.       .::||..|:..:..:||.:        |
Mouse   325 GGTQLPSSTFPNTSVPDSSPDSMQLSTVGG-------SNQLSSYYNPFSGGSSGDQSSPFSSPFY 382

  Fly   933 NYMGAN 938
            |:...|
Mouse   383 NFSMVN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 35/85 (41%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 37/95 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.