DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and FOXE1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_004464.2 Gene:FOXE1 / 2304 HGNCID:3806 Length:373 Species:Homo sapiens


Alignment Length:404 Identity:93/404 - (23%)
Similarity:141/404 - (34%) Gaps:121/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 PPPPNMTPTSQVHNGSLGGGGGGGGGSGGGGGGGGANLRSPNSYASYDNEDSLKEFDLVVSSRLH 647
            ||.|.:..|.:...|....|.|..|.:.|.|.||                               
Human     9 PPQPEVLATVKEERGETAAGAGVPGEATGRGAGG------------------------------- 42

  Fly   648 TSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMA 712
                                             :::|.|..         ..|||||:.:||.||
Human    43 ---------------------------------RRRKRPLQ---------RGKPPYSYIALIAMA 65

  Fly   713 IEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKV-EKAPNMGKGSLWRVE 776
            |..:.|:.|.:..||.:|.:.||:::..|..|:||:||||:||..|:|: .:|...|||:.|.::
Human    66 IAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALD 130

  Fly   777 PQQRQNLIQA---LNRSPFFPNSAVDKISPSLKSPSGGSAYDSLDGGGS----GSVSSAQPVAGG 834
            | ..:::.::   |.|...|..|.:......:...:..:|..:.....:    |:|.:|:|...|
Human   131 P-NAEDMFESGSFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAAAAAAIFPGAVPAARPPYPG 194

  Fly   835 AGVPAAAAVALSTPTKSNGLALANGASQATNAA--RPHSPNGG----GSGSHARFDPYLFPNLSK 893
            |.....|..:|:.|......|.:.|..:.....  ||.||..|    |.|....|          
Human   195 AVYAGYAPPSLAAPPPVYYPAASPGPCRVFGLVPERPLSPELGPAPSGPGGSCAF---------- 249

  Fly   894 AFRNIREDTVG-QPMLQDALDDELSGDYHNNNNNNSGSKYNYMGANGS--GGAGS---------- 945
            |.......|.| ||          :|.......|.|.....|.|.:|:  .||||          
Human   250 ASAGAPATTTGYQP----------AGCTGARPANPSAYAAAYAGPDGAYPQGAGSAIFAAAGRLA 304

  Fly   946 GGVGSNANGASDGI 959
            |.....|.|:|.|:
Human   305 GPASPPAGGSSGGV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 35/85 (41%)
FOXE1NP_004464.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..51 10/104 (10%)
FH 53..141 CDD:214627 35/88 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.