DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and FOXI1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_036320.2 Gene:FOXI1 / 2299 HGNCID:3815 Length:378 Species:Homo sapiens


Alignment Length:397 Identity:99/397 - (24%)
Similarity:154/397 - (38%) Gaps:135/397 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 SVSPPPPNM------------TPTSQVHNGSLGGGGGGGGGSGGGGGGGGANLRSPNSYASYDNE 632
            |:...||.|            .|:.|  ..|..|||..|.              :||.|..::..
Human    20 SIGQEPPEMNLYYENFFHPQGVPSPQ--RPSFEGGGEYGA--------------TPNPYLWFNGP 68

  Fly   633 DSLKEFDLVVSSRLHTST-PQYSVSKNGA----NGYGNGN---SNVNGSGAGSN-----TPQKQK 684
                           |.| |.|....|.:    ..||...   .:|:|.| ||:     .|.:::
Human    69 ---------------TMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLG-GSDLGWLPIPSQEE 117

  Fly   685 HPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVR 749
            ....|          :||||:|:||.|||.|:.:|.|.:.:||.::..:||::..:..||:||:|
Human   118 LMKLV----------RPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIR 172

  Fly   750 HNLSLNKSFVKVEK-APNMGKGSLWRVEP--------------QQRQNLIQALNRSPFFPNSAVD 799
            ||||||..|.||.: ..:.|||:.|.::|              ::|::.:.:...|     .|::
Human   173 HNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTAS-----LALE 232

  Fly   800 KISPSL--KSPSGGSAYDSLDG---GGSGSVSSAQPVAGGAGVPA--------AAAVALSTPTK- 850
            |...||  .||......|.|||   ||:.|....:|....:|.|.        .|.|:..:||. 
Human   233 KTESSLPVDSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSPTSH 297

  Fly   851 ----------------SNGLALANGASQATNAARPHSPNGGGSGSH--------------ARFDP 885
                            .|.|.. |..|..||.:. ||  |||..::              ::|.|
Human   298 PLVTPGLSPEPSDKTGQNSLTF-NSFSPLTNLSN-HS--GGGDWANPMPTNMLSYGGSVLSQFSP 358

  Fly   886 YLFPNLS 892
            :.:.:::
Human   359 HFYNSVN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 37/99 (37%)
FOXI1NP_036320.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 1/5 (20%)
FH 123..211 CDD:214627 36/87 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..278 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.