DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and FOXJ3

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_005270689.1 Gene:FOXJ3 / 22887 HGNCID:29178 Length:630 Species:Homo sapiens


Alignment Length:434 Identity:112/434 - (25%)
Similarity:183/434 - (42%) Gaps:104/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 DNEDSLKEFDLVVSSRLHTS----------TPQYSVSKNGA--NGYGNGNSNVNGSGAGSNTPQK 682
            :.|||: .:...::|.|.:|          |.:.::.|:.|  |.:|.|.|..|.. ...||...
Human    13 NQEDSI-YWQCRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNAL-LDPNTTLD 75

  Fly   683 QKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNS 747
            |:....       |.:.|||||::|||..||..|.:|.:.:.|||.||..:|||::.|.:|||||
Human    76 QEEVQQ-------HKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNS 133

  Fly   748 VRHNLSLNKSFVKVEKA-PNMGKGSLWRVE-----------PQQRQNLIQALNRSPFFPNSAVDK 800
            :||||||||.|:||.:: .:.||||.|.::           |::|...::..: :|:    ::|.
Human   134 IRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDVLPTRPKKRARSVERAS-TPY----SIDS 193

  Fly   801 ISPSLKSPSGGSAYDSL--------------DGGGSGSVSSA-------QPVAGGAGVPAAAAVA 844
            .|..::....|||..:|              |..||.|..|:       |.:| ...:.:..:|.
Human   194 DSLGMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLA-SVNLNSVGSVH 257

  Fly   845 LSTPTKSNGLALANGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQPMLQ 909
            ..||..|:    ....||:....:....|.........|..|.|.:||.:||::.:....|.:.|
Human   258 SYTPVTSH----PESVSQSLTPQQQPQYNLPERDKQLLFSEYNFEDLSASFRSLYKSVFEQSLSQ 318

  Fly   910 DAL---DDELSGDYHNN---NNNNSGSKYNYMGANGSGGAGSGGVGSNANGASDGINFARLARDC 968
            ..|   ..|.|...|.:   .::.|.:...:..:|.|..:.|.|.|.|..|::            
Human   319 QGLMNIPSESSQQSHTSCTYQHSPSSTVSTHPHSNQSSLSNSHGSGLNTTGSN------------ 371

  Fly   969 GADSIDDVHAAAAMLYLKHGPKIYSEPFQNGSGPVITSSPSEDH 1012
                      :.|.:.|.| |:::::|           ||...|
Human   372 ----------SVAQVSLSH-PQMHTQP-----------SPHPPH 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 44/96 (46%)
FOXJ3XP_005270689.1 Forkhead 86..163 CDD:278670 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.