DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and fkh-2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_508644.1 Gene:fkh-2 / 180663 WormBaseID:WBGene00001434 Length:270 Species:Caenorhabditis elegans


Alignment Length:218 Identity:63/218 - (28%)
Similarity:96/218 - (44%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 DNEDSLKEFDLVVSSRLHTST-----PQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNV 689
            |...|:...|.:.:..||..:     .:.::||:                  |.:|.........
 Worm    40 DPSTSIDTTDTMSTDYLHDESIDDERSESTLSKD------------------SKSPSSSNSEEKT 86

  Fly   690 PYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSL 754
            |..|    |:|||:|:::||.|||:.|.||.|.:..||.:||.::|:::....||:||:||||||
 Worm    87 PSSP----NDKPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSL 147

  Fly   755 NKSFVKVEK-APNMGKGSLWRVEPQQRQNLIQALNRSPFFPNSAVDKI--SPSLKSPSGGSAYDS 816
            ||.||||.: ..:.|||:.|         ::.|......|...|..|:  .||..|.:...||..
 Worm   148 NKCFVKVPRNFDDPGKGNYW---------MLDATAEDEVFIGGATGKLRRRPSSLSRARMDAYKQ 203

  Fly   817 LDGGGSGSVSSAQPVAGGAGVPA 839
            .....:.......|     |:||
 Worm   204 YGAAAANLFPYFSP-----GMPA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/85 (45%)
fkh-2NP_508644.1 FH 93..170 CDD:238016 38/85 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.