DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and pes-1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:156 Identity:56/156 - (35%)
Similarity:79/156 - (50%) Gaps:19/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 SPNSYASYDNEDSLKEF---DLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQ 683
            :|...||..| ..:|.|   ||.:.....||:   |.|.:.|:.:...:.:|....:|.|:|...
 Worm    25 TPPKTASPGN-SKMKGFNISDLCLDLDSSTSS---SCSVSPASSFHTRSESVGQQQSGRNSPVSS 85

  Fly   684 KHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKT-APNGWKNS 747
            ...:         ...:|.||:::||.|||:.|..|:|.|.|||.:|..:|.|:|. .|..|:||
 Worm    86 STES---------PTKRPKYSYNALIAMAIQSSPFKSLRVSEIYKYISSNFSYYKNQKPLQWQNS 141

  Fly   748 VRHNLSLNKSFVKVEKAPNMGKGSLW 773
            |||||||:|.|.||....  ||||.|
 Worm   142 VRHNLSLHKEFRKVRTLD--GKGSYW 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 39/75 (52%)
pes-1NP_001023406.1 FH 93..168 CDD:238016 39/75 (52%)
rad23 <203..>240 CDD:273167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.