DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and unc-130

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_496411.1 Gene:unc-130 / 174721 WormBaseID:WBGene00006853 Length:333 Species:Caenorhabditis elegans


Alignment Length:162 Identity:52/162 - (32%)
Similarity:76/162 - (46%) Gaps:42/162 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 ANLRSPNSYASYD-NEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQ 681
            ||.|:.::.::.| :.|..|:.|          ....|.|:...:|:                 :
 Worm    84 ANKRNHSTSSAADSSSDDAKDDD----------DDDDSTSRKSMSGH-----------------R 121

  Fly   682 KQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKN 746
            |..|.             |||||:.:||.|:|..|.||.|.:.||..:|:..|.|:|.....|:|
 Worm   122 KSSHA-------------KPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQN 173

  Fly   747 SVRHNLSLNKSFVKVEKAP-NMGKGSLWRVEP 777
            |:|||||||..||||.:.| |.|||:.|.::|
 Worm   174 SIRHNLSLNDCFVKVARGPGNPGKGNYWALDP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 40/79 (51%)
unc-130NP_496411.1 COG5025 <126..330 CDD:227358 40/93 (43%)
Forkhead 127..212 CDD:365978 40/79 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.