DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and let-381

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_491826.1 Gene:let-381 / 172331 WormBaseID:WBGene00002601 Length:362 Species:Caenorhabditis elegans


Alignment Length:310 Identity:76/310 - (24%)
Similarity:122/310 - (39%) Gaps:92/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 SYDNEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYD 692
            :|.|||                  :...::|......:...:.:|.|..|   :|:|        
 Worm    35 NYFNED------------------EEDYNENSHEDSEDSKEDSDGQGCRS---RKRK-------- 70

  Fly   693 PLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKS 757
                  .|||:|:.:||.|||....:|...:.|||:::.::|.:|:....||:||:|||||||:.
 Worm    71 ------EKPPFSYIALIAMAISKRPDKKATLAEIYSYLQENFEFFRGEYAGWRNSIRHNLSLNEC 129

  Fly   758 FVKVEKAPNMG----KGSLWRVEP-----------QQRQNLIQALNRSPFFPNSAVDKISPSLKS 807
            |||:.|.....    ||..|.:..           ::|....:|..|: .||.     ::.|.:.
 Worm   130 FVKLPKDTGESYRGRKGHKWTISDSCEFMLEENGFRRRPRGYKARKRT-HFPG-----VTASNEM 188

  Fly   808 PSGGSAYD------SLDGGGSGSVSSAQP---VAGGAGVPAAAAVALSTPTKSNGLALANGASQA 863
            ..||:.:|      .|...|:.|:::...   :.||.....:.:..|.:.|.|..|...||..|:
 Worm   189 GIGGATFDYPSSTTELTDSGTSSLNTDVKNILLNGGEDFGPSISDQLVSSTTSAVLPSLNGPDQS 253

  Fly   864 TNAARPHSPNGGGSGSHARFD----------PYL-----------FPNLS 892
                 |..||..|.|: |.|.          ||.           ||.:|
 Worm   254 -----PIYPNYFGYGT-AEFPMQWASPTYDWPYYATPHIGLCSSDFPGIS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 34/99 (34%)
let-381NP_491826.1 Forkhead 71..160 CDD:365978 33/88 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.