DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxe3

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:286 Identity:82/286 - (28%)
Similarity:114/286 - (39%) Gaps:71/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 SVSKNGAN-----GYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAI 713
            |||.:|..     |...|.......|.|.:.|.....|......||  ...|||||:.:||.||:
  Rat    15 SVSPSGPQPPSLAGDEPGREPEEVVGGGDSEPPAAPGPGRRRRRPL--QRGKPPYSYIALIAMAL 77

  Fly   714 EGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAP-NMGKGSLWRVEP 777
            ..:..:.|.:..||.:|.:.|.:::.:|..|:||:||||:||..||||.:.| |.|||:.|.::|
  Rat    78 AHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPREPGNPGKGNYWTLDP 142

  Fly   778 ------------QQRQNL----IQALNRSPF----FPNSAVDKISPSLKSPSGGSAYDSLDG--- 819
                        ::|:..    :.|....||    ||.:.    :|:...|:.....|||.|   
  Rat   143 AAADMFDNGSFLRRRKRFKRTELPAPPPPPFPYAPFPPAP----APAPAPPARLFRLDSLLGLQT 203

  Fly   820 GGSGSVSSAQP--VAGGAGVPAAAAVALSTPTKSNG---------------LALANGASQATNAA 867
            ...|.::...|  .|..|..|..||.| |.|..|..               ||||..|...    
  Rat   204 EPPGPLAPEPPCCAAPDASFPPCAAAA-SPPLYSPAPERLGLPAPLPAEPLLALAGSAGAL---- 263

  Fly   868 RPHSPNGGGSGSHARFDPYL----FP 889
               .|.|.|       :.||    ||
  Rat   264 ---GPLGAG-------EAYLRQPGFP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 36/101 (36%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 12/48 (25%)
FH 64..152 CDD:214627 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.