DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxl1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_032050.2 Gene:Foxl1 / 14241 MGIID:1347469 Length:336 Species:Mus musculus


Alignment Length:323 Identity:82/323 - (25%)
Similarity:125/323 - (38%) Gaps:99/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 VHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFV 759
            |....|||||:.:||.|||:.:.|:.:.:..||.:|:..||::.....||:||:|||||||:.||
Mouse    44 VEPPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFV 108

  Fly   760 KVEKAPNM-GKGSLWRVEP-----------QQRQNLIQALNRSPFFPNSAVD----KISPSLKSP 808
            ||.:.... ||||.|.::|           ::|:...:....||....:.|:    ::...:.||
Mouse   109 KVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEAKRTRVEPPESEVGCDVGSP 173

  Fly   809 SGGSAYDSL--DGGGSGSVSSAQP-----------------VAGGAGVPAAAAVALSTPTKSNGL 854
            ...:|..:.  |...|.:|.:|:|                 ...|||  |.|:..|..|....|.
Mouse   174 DLATALPTRAPDRSQSPAVGTARPALLPWPGPEPRDPDADLTVQGAG--AVASGQLQRPAHHLGS 236

  Fly   855 ALANGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQPMLQDALDDELSGD 919
            .|.            .:|:|...||.           ||:|               ::|..|:  
Mouse   237 PLC------------PAPSGSPKGSK-----------SKSF---------------SIDSILA-- 261

  Fly   920 YHNNNNNNSGSKYNYMGANGSGGAG-----SGGVGSNANGASDGINFARLARDCGADSIDDVH 977
                        .....|:|:...|     .|.:||:...||.|     ||....|..:.|.|
Mouse   262 ------------VRPTPASGAEAPGIPKPVPGALGSSLLAASSG-----LAPPFNASLVFDAH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/96 (40%)
Foxl1NP_032050.2 FH 49..137 CDD:214627 37/87 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..214 12/73 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..252 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.