DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxd4

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:253 Identity:68/253 - (26%)
Similarity:97/253 - (38%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKA 764
            |||||:.:||.|||..|..|.|.:..|.|:|...|||::.....|:||:|||||||..|||:.:.
Mouse   103 KPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPRE 167

  Fly   765 P-NMGKGSLWRVEPQQRQ-----NLIQALNR---------------------------------- 789
            | :.|||:.|.::|..:.     :.::...|                                  
Mouse   168 PGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPPSGGHPHCPFPPPAVPATLHVSQPSLLL 232

  Fly   790 ---SPFFPNSAVDKISPSLKSPS-------------GGSAYDSLDGGGSGSVSSAQPVAGGAGVP 838
               :|..||.|....:|....|.             ...||    |........|.| |....:|
Mouse   233 RYSAPPQPNLAAHPAAPPRSHPCAPLHPHPMRYLLLAAPAY----GDNPRKAEGADP-ATPLAIP 292

  Fly   839 AAAAVALSTP---TKSNGLALANGASQATNAARPHSPNGGGSGS--HARFDPYLFPNL 891
            |...|..|.|   .:|:|.....|.:..|..:......|||:||  ...|.|:.:.:|
Mouse   293 ALQPVLGSQPWERDQSSGTRSGRGCASFTIESIMQGVTGGGTGSAQSPSFAPWSYCHL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/90 (42%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Forkhead 103..189 CDD:278670 38/85 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.