DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxn2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001342671.1 Gene:Foxn2 / 14236 MGIID:1347478 Length:429 Species:Mus musculus


Alignment Length:357 Identity:114/357 - (31%)
Similarity:158/357 - (44%) Gaps:88/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 SPPPPNMTPTSQVHN-GSLGGGGGGGGGSGGGGGGGGANLRSPNSYASYDNEDSLKEFDLVVSSR 645
            :|....:...||::. |||...|..........|...|:....|....:::.:.|....| .|..
Mouse    15 TPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSESADDELTNLNWLHESSNLLTNLRL-GSEG 78

  Fly   646 LHTSTPQYSVSKN-----GANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSF 705
            |...:|.|.:..:     |.:.|.|              |:|:.            ..:||||||
Mouse    79 LPMVSPLYDIEGDEMPSFGPSCYQN--------------PEKKS------------ATSKPPYSF 117

  Fly   706 SSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNM--G 768
            |.||:||||.|..|.|||||||:||:..||||.|||.||||||||||||||.|.|||::...  |
Mouse   118 SLLIYMAIEHSPNKCLPVKEIYSWILDRFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNG 182

  Fly   769 KGSLWRVEPQQRQNLIQALNRSPF-FPNSAVDKISP-----SLKSPSGGSAYDS-LDGGGSG--- 823
            |||||.|:|:.:.||:|||.:.|| .|.||.  :||     :||.....:..:| :|...:.   
Mouse   183 KGSLWCVDPEYKPNLMQALKKQPFSSPQSAA--LSPHCLSSALKQSQVQTLQESDIDAATAMILL 245

  Fly   824 SVSSAQPV-----------------AGGAGVPAAAAVALS---TPT-----------KSNGLALA 857
            :.|..|.:                 :.|:...|..||.|.   :||           .:|.:|..
Mouse   246 NTSIEQEILECEKPLPLKTSLQKKRSYGSAFSAPGAVRLQESPSPTAGIDPKADHNYSANSVAAQ 310

  Fly   858 NGASQATNAAR----------PHSPNGGGSGS 879
            ..||:|:.::.          |.|.:||..||
Mouse   311 RCASRASMSSLSSVDEVYEFIPKSSHGGSDGS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 59/86 (69%)
Foxn2NP_001342671.1 FH_FOXN2 111..192 CDD:410832 56/80 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5393
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005460
OrthoInspector 1 1.000 - - otm43077
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5832
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.