DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxh1

DIOPT Version :10

Sequence 1:NP_511071.3 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_032015.1 Gene:Foxh1 / 14106 MGIID:1347465 Length:401 Species:Mus musculus


Alignment Length:303 Identity:80/303 - (26%)
Similarity:115/303 - (37%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   638 FDLVVSSRLHTSTPQYSVSKNGANGY-----GNGNSNVNGSGAG--SNTPQKQKHPNNVPYDPLV 695
            :||..:....|.:||.:::.  |.||     ...||.:....|.  |.||:::|...      |.
Mouse     5 WDLASTYTPTTPSPQLALAP--AQGYLPCMGPRDNSQLRPPEAESLSKTPKRRKKRY------LR 61

  Fly   696 HTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVK 760
            |  :||||::.::|.:.|:.:..:.|.:.:|...:...||:|:....|||:|:|||||.|:.|.|
Mouse    62 H--DKPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFHK 124

  Fly   761 VEKAP--NMGKGSLWRV-------EPQQRQNLI--------------------QALNRSPFFPNS 796
            |.|.|  ...||:.|.|       |..:.||..                    ..|:..|:.|  
Mouse   125 VPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGTHRAFAKDLSPYVLHGQPYQP-- 187

  Fly   797 AVDKISPSLKSP--SGGSAYDSLDGGGSGSVSSAQPVAGGAGVP----AAAAVALST-------- 847
                  ||...|  .|.|....|...|..|.....|     |:|    ||.|..||.        
Mouse   188 ------PSPPPPPREGFSIKSLLGDPGKESTWPQHP-----GLPGQSTAAQAGTLSKGEEGMGTG 241

  Fly   848 PTKSN-----------GLALANGASQATNAARPHSPNGGGSGS 879
            |:.|:           |..:..|.|......|| ||.....||
Mouse   242 PSSSSETPLWPLCSLPGPTIIEGESSQGEVIRP-SPVTPDQGS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_511071.3 FH_FOXN2-like 700..775 CDD:410805 29/76 (38%)
Foxh1NP_032015.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..57 6/24 (25%)
FH_FOXH 64..142 CDD:410796 29/77 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 21/84 (25%)
SMAD-interaction domain (SID) 307..390
Fast/FoxH1 motif 1 (FM1) 311..315
Fast/FoxH1 motif 2 (FM2) 321..327
SMAD interaction motif (SIM) 363..384
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.