DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxj1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_446284.2 Gene:Foxj1 / 116557 RGDID:621764 Length:421 Species:Rattus norvegicus


Alignment Length:403 Identity:101/403 - (25%)
Similarity:151/403 - (37%) Gaps:129/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 GGGGGSGGGGGGGGANLRSPNSYASYDNEDS------LKEFDLVVSSRLHTSTPQYSVSKNGANG 662
            |.|.|...|..||   :..|::.     :||      |:||.:     |:...|.........:|
  Rat    10 GAGPGEEAGPEGG---MEEPDAL-----DDSLTSLQWLQEFSI-----LNAKAPTLPPGGTDPHG 61

  Fly   663 YGN------------------GNSNVNGSGAGSNTPQ------KQKHPNNVPYDPLVHTNNKPPY 703
            |..                  |..:..|....|.|.:      :...|::|.|....|.  ||||
  Rat    62 YHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHV--KPPY 124

  Fly   704 SFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPN-M 767
            |:::||.||::.|....:.:..||.||..:|.||:.|...|:||:||||||||.|:||.:..: .
  Rat   125 SYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEP 189

  Fly   768 GKGSLWRVEPQQRQNLIQA---------LNRSPFFPNSAVDKISPSLKSPSGG------------ 811
            |||..||::||..:.|:..         ::..|.|...|..:  || .:|.||            
  Rat   190 GKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQE--PS-TAPWGGPLTVNREAQQLL 251

  Fly   812 SAYDSLDG-GGSGSVSSAQPVAGGAG---------VPAAAAVALSTPT----------------- 849
            ..::...| ||.|:         |.|         :|...|..|..|:                 
  Rat   252 QEFEEATGEGGWGT---------GEGRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQGELEPLKG 307

  Fly   850 --------KSNGLALANGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIR-EDTVGQ 905
                    ::..|.....:.:....:.|.||:     ||...|      |:...|:|. ..|.|.
  Rat   308 NFDWEAIFEAGALGEELSSLEGLELSPPLSPS-----SHGEVD------LTVHGRHINCPATWGP 361

  Fly   906 PMLQ--DALD-DE 915
            |:.|  |:|| ||
  Rat   362 PVEQATDSLDFDE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 40/85 (47%)
Foxj1NP_446284.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 4/30 (13%)
FH_FOXJ1 121..199 CDD:410797 37/77 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..277 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.