DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxq1a

DIOPT Version :10

Sequence 1:NP_511071.3 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001230273.1 Gene:foxq1a / 100537750 ZFINID:ZDB-GENE-070424-74 Length:312 Species:Danio rerio


Alignment Length:128 Identity:47/128 - (36%)
Similarity:69/128 - (53%) Gaps:16/128 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKA 764
            |||||:.:||.|||..||...|.:.||..::::.||:|:.:..||:||||||||||..|:||.:.
Zfish    88 KPPYSYIALIAMAIRDSNSGRLTLAEINDYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFLKVLRD 152

  Fly   765 PN--MGKGSLWRVEP------------QQRQNLIQALNRSPFFP--NSAVDKISPSLKSPSGG 811
            |:  .||.:.|.:.|            ::|:.:.:...|.|..|  ..|:|........||.|
Zfish   153 PSRPWGKDNYWMLNPHSEYTFADGVFRRRRKRISKKTGREPEGPVQTHALDSNDSIATPPSSG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_511071.3 FH_FOXN2-like 700..775 CDD:410805 37/76 (49%)
foxq1aNP_001230273.1 FH_FOXQ1-like 88..166 CDD:410808 37/77 (48%)

Return to query results.
Submit another query.