DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxd2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_002931458.1 Gene:foxd2 / 100495241 XenbaseID:XB-GENE-479818 Length:348 Species:Xenopus tropicalis


Alignment Length:354 Identity:91/354 - (25%)
Similarity:130/354 - (36%) Gaps:119/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 SPNSYASYDNEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGA------GSNTP 680
            |.||..|.|.       |:.|...:.....:||...:..:...||.....|..|      ||.:.
 Frog     8 SDNSLLSEDT-------DIDVVGDMGAKDGKYSDYHSDNDSDDNGPRTHRGDPASPDLSSGSESN 65

  Fly   681 QKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWK 745
            |:.:.|   |.:.||    |||||:.:||.|||..|.:|.|.:.||..:|...|||::.....|:
 Frog    66 QRAEKP---PKNALV----KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQ 123

  Fly   746 NSVRHNLSLNKSFVKVEKAP-NMGKGSLWRVEPQ------------------------------- 778
            ||:|||||||..|||:.:.| |.|||:.|.::|:                               
 Frog   124 NSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQSNEILRDPSS 188

  Fly   779 -----------------QRQN-------------------------LIQALNRSPFFPN-----S 796
                             |.||                         :..:...|||..|     |
 Frog   189 FMPAAFGYGPYGYNYGLQLQNYHQHHHTGATFSFQPTHCPLPPPASVFSSPTLSPFLGNELTRKS 253

  Fly   797 AVDKISPSLK-----SPSGGS----AYDSLDGGGSGSVSSAQP--VAGGAGVPAAAAVALSTPTK 850
            ...::||:|.     .|.|.|    :.|::.||...:.|...|  |..|...|..|.::.|....
 Frog   254 FYSQLSPTLPILQTLKPDGQSRPSFSIDNIIGGSGSTPSPTSPYTVQPGNQPPVIAMLSPSLAPM 318

  Fly   851 SNGLALA---------NGASQATNAARPH 870
            .|.|.|:         |.:|:.||.:..|
 Frog   319 QNHLNLSHENLLPSGQNFSSKITNLSSCH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 42/158 (27%)
foxd2XP_002931458.1 Forkhead 78..163 CDD:365978 39/84 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.