DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxm1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_002941428.1 Gene:foxm1 / 100492241 XenbaseID:XB-GENE-854081 Length:754 Species:Xenopus tropicalis


Alignment Length:512 Identity:125/512 - (24%)
Similarity:186/512 - (36%) Gaps:141/512 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 TSAASNSSSSSNSTPNSQAILHGQESPAVVTTTTLISAGTLPPGYSFVNQVASTPHVLSTPAHVA 542
            :|....::.:..:.|..|.::||.|..|   :.|....|...|.....:....||.: ..||:..
 Frog    29 SSQQGKAAMNKMANPPEQTLVHGLEDMA---SKTKAHQGAPGPNLGSESGDPITPRI-GLPANSQ 89

  Fly   543 S--PETPPGAALLPGTYYATSTTSAGTTTTTLQARSLQLSVSPPPPNMTPTSQVHNGSLGGGGGG 605
            .  .|..||  .:||.......|:..|          ||.:.|...|:....|    :|...|..
 Frog    90 QNCQEGVPG--FIPGVRIVGHPTTPDT----------QLVIIPSQSNVQSIIQ----ALTARGKE 138

  Fly   606 GGGSGGGGGGGGANLRSPNSYASYDNEDS-----------LKEFDLVV---------------SS 644
            .||              ||.|....:|.:           :||.:...               ||
 Frog   139 NGG--------------PNKYIIISSESAIQTQAWQQALQIKEEESAPLQSEAACLSKKKPTGSS 189

  Fly   645 R--LHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKH---PNNVPY------------- 691
            |  .|....|.:.|.:.....|    |::....|..:.::::|   .|.:|.             
 Frog   190 RKAKHQQEEQLNASLSNIQWLG----NMSSESLGQYSIKEEEHEDKENQIPETGCPKMEDESQLF 250

  Fly   692 -DPL--VHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFK-TAPNGWKNSVRHNL 752
             ||.  |....:||||:.:||..||..:..|.:.:|:||.||..|||||| .|..|||||:||||
 Frog   251 PDPQWPVSVTERPPYSYMALIQFAINSTPRKRMTLKDIYTWIEDHFPYFKHVAKPGWKNSIRHNL 315

  Fly   753 SLNKSFVKVEKAPNMGKGSLWRVEPQQRQNLI------QALNRSPFFPNSAVDKISPSLKSPSGG 811
            ||:..||:..:|.|  |.|.|.:.||..:.|.      .|::.||........|:.|.::.....
 Frog   316 SLHDMFVRESEANN--KVSYWTIHPQANRCLTLDQVFKTAVSMSPADDEPQQKKMIPDIRKSLQS 378

  Fly   812 SAYDS---------LDGGGSGSVSSAQPVAGGAGVPAA-----AAVALSTPTKSNGLALANGASQ 862
            :||.|         |....|..:....|||....:||.     .|..|.....|..:.:|..|: 
 Frog   379 AAYASNKERKMKPLLPRVNSYLIPVHFPVAQPVLLPATEPYAYEAECLDRHQSSKRVKIAPKAA- 442

  Fly   863 ATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQPMLQDALDDELSGD 919
            |.|...|.               |:.|      |:::|    :|.:.|     |:||
 Frog   443 ADNGESPQ---------------YIEP------RSVKE----EPEITD-----LNGD 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 42/91 (46%)
foxm1XP_002941428.1 FH 262..337 CDD:238016 39/76 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.