DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxl1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_012817795.1 Gene:foxl1 / 100038263 XenbaseID:XB-GENE-5880620 Length:406 Species:Xenopus tropicalis


Alignment Length:492 Identity:110/492 - (22%)
Similarity:163/492 - (33%) Gaps:189/492 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 VSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSG-AGSNTPQKQKHPNNVPYDPLVHTNNKPPYSF 705
            :.|.||.|...|.        ||...:.|...| |.:|...:|:.|            .|||||:
 Frog    12 LGSDLHRSPLVYL--------YGAERALVPALGFASTNVISRQEPP------------QKPPYSY 56

  Fly   706 SSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNM-GK 769
            .:||.|||:.|.:..:.:..||.:|:..||::.....||:||:|||||||..|:||.:.... ||
 Frog    57 IALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGK 121

  Fly   770 GSLWRVEPQ-----QRQNLIQALNRSPFFPNSAVDKISPSL-----KSPSGGSAYDSLDGGGSGS 824
            ||.|.::|:     :..| .:...|.|          .|.|     :..:..:.|...|....|:
 Frog   122 GSYWTLDPKCLDMFENGN-FRRRKRKP----------KPILCQEGKRHKAEAAEYRLADAACKGT 175

  Fly   825 VSSAQPVAGGAGVPAAAAVALSTPTKSNGLALANGASQATNAARPHSPNGGGSGSHARFDPYLFP 889
            ...   |||..|                    .||:..|....:|.|.                 
 Frog   176 TCK---VAGNTG--------------------QNGSQDAPLGRKPTSA----------------- 200

  Fly   890 NLSKAFRNIREDTVGQPMLQDALDDELSGDY--------HNNNNNNSGSKYNYMGANGSGGAGSG 946
                    ..:|:.|:  :..:.|:..||||        .:|....||:.:|             
 Frog   201 --------CEKDSAGE--MSSSEDEGGSGDYIKTSPAPECHNQERTSGTYWN------------- 242

  Fly   947 GVGSNANGASDGINFARLARDCGADSIDDVHAAAAMLYLKHGPKIY-SEPFQNGSGPVITSSPSE 1010
                                        .:|           |..| |.|..  |..|..||..|
 Frog   243 ----------------------------SLH-----------PSFYVSVPLL--SDQVTLSSKRE 266

  Fly  1011 DHTYSAGGNSNADSGSSTPLTNGNALASVAQ----AVAQGQNNQGGAGSDSNCASSDAAYDSSEE 1071
                          ||.........||..||    |.:.|.||:....:|:||..:         
 Frog   267 --------------GSQAHEQGNRLLACGAQGHLGAPSPGSNNEKAGATDANCKEA--------- 308

  Fly  1072 NHNITPEEMADRQRHRDGVDALLSLSGSSIVECGSVA 1108
                  |:::.:......:|::||.|..|..|||:.|
 Frog   309 ------EQLSQKSARSFSIDSILSRSDQSAPECGAPA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 37/90 (41%)
foxl1XP_012817795.1 Forkhead 50..136 CDD:365978 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.