DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxe1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:349 Identity:89/349 - (25%)
Similarity:135/349 - (38%) Gaps:102/349 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 NGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFP 735
            ||...|.:||:.::...     ||  ...|||||:.:||.|||..|.::.|.:..||.:|.:.||
 Frog    44 NGGSEGEDTPKGRRRKR-----PL--QKGKPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFP 101

  Fly   736 YFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNM-GKGSLWRVEPQ-----------------QRQN 782
            :::.....|:||:||||:||..|:|:.:.|.. |||:.|.::|.                 :|.:
 Frog   102 FYRDNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGNYWALDPNAEDMFDSGSFLRRRKRFKRTD 166

  Fly   783 L------------------IQALNRSPFFPN-----SAVDKISP--SLKSPSGGSAYDSLDG--- 819
            |                  .:|...:..:||     |...:|:|  |:..||...|:.|...   
 Frog   167 LTTYPAYIHDTSMFSPLQVARATYPNTVYPNMTMSPSYSQQIAPHSSVYYPSSSPAFSSAQPRVF 231

  Fly   820 ------GGSGSVSSAQPVA----------------GGAGVPAAAAVALSTPTKSN--GLALANGA 860
                  |.|||..:.||..                ||:...:.|......|..:|  ..::.|..
 Frog   232 SINTLIGHSGSEHAQQPNRSISPEVNSTSSSSCNYGGSTYSSQAGSGTMLPRSTNPYSYSVPNSH 296

  Fly   861 SQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQPMLQDALD--DELS-GDY-- 920
            .|...::.||| |....||.:|......|                ||..||:|  ..:| |.|  
 Frog   297 LQMNQSSYPHS-NAQLFGSASRLPMPTSP----------------PMNSDAVDFYGRMSPGQYTS 344

  Fly   921 ---HNNNNNNSGSKYNYMGANGSG 941
               :|:|....|:......|..||
 Frog   345 LTTYNSNGQLGGTNAYLRHATYSG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 36/120 (30%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.