DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and si:ch211-145o7.3

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_001923743.3 Gene:si:ch211-145o7.3 / 100003583 ZFINID:ZDB-GENE-061207-6 Length:332 Species:Danio rerio


Alignment Length:224 Identity:84/224 - (37%)
Similarity:116/224 - (51%) Gaps:46/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   574 ARSLQLSVSPPPPNMTPTSQVHNGSLGGGGGGGGGSGGGGGGGGANLRSPNSYASYDNEDSLKEF 638
            :.:|.||.|.|.|....:|.:|:            |......||::..|.::....|        
Zfish    21 SEALPLSPSLPQPASLHSSHLHS------------SSSPRVSGGSHCLSLSTAPEQD-------- 65

  Fly   639 DLVVSSRLH---TSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNK 700
            ||...:.||   ...|...:.|.                  |..||..   :.:|...|..:..|
Zfish    66 DLTCLNWLHQRGNLLPLQPLPKI------------------STLPQMF---DPIPAQHLPSSPAK 109

  Fly   701 PPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKV--EK 763
            ||||||||||||||.|.||:||||.||.|||::|||:|.||.||:|||||||||:|||.::  :|
Zfish   110 PPYSFSSLIFMAIEDSPEKSLPVKGIYEWIVENFPYYKEAPGGWRNSVRHNLSLSKSFQRIHRDK 174

  Fly   764 APNMGKGSLWRVEPQQRQNLIQALNRSPF 792
            :.::||||||||.|:.|..|::.|.::.:
Zfish   175 SQSVGKGSLWRVCPEYRPALLEVLRKTHY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 59/86 (69%)
si:ch211-145o7.3XP_001923743.3 Forkhead 109..196 CDD:278670 59/86 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5337
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0005460
OrthoInspector 1 1.000 - - otm24864
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.