DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA7a and CG18536

DIOPT Version :9

Sequence 1:NP_572395.2 Gene:CheA7a / 31672 FlyBaseID:FBgn0029948 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster


Alignment Length:177 Identity:42/177 - (23%)
Similarity:78/177 - (44%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLVHSCRAEKPYSVELNTFTMDDTIENQENWVDWGTLSMKKVSRNQFVVSGDFEFKLNMADEQKI 75
            :|.|...|.:.:..|....|...:.|::..:    ...::::.|:.:.:|...|:|.:..:|  .
  Fly    18 ILFHLTAASRKWDYEPILLTATSSDESKLKF----EAKIERLGRSDYGLSAILEWKYDTNEE--T 76

  Fly    76 VLMVYVYDSNANQRGS---MVMAV-KKPFCQFIK---EDEDSYPSIQKASNLP---DQDTCPFPK 130
            ::....|.||:.....   :..|: |:||..:|.   :|..| .::...||||   |:...|:||
  Fly    77 MVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVIS-KNLGYCSNLPKYEDKFQPPWPK 140

  Fly   131 GKYTIDNYELETNFLPDNAPKGDYLLQLSLLDREVPVAGLVATVTLT 177
            ..|.:|..::..:.||:.||.|.|.:..:......|..|..|...||
  Fly   141 NTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLT 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA7aNP_572395.2 DM8 89..177 CDD:214778 26/97 (27%)
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.