DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA7a and CheA7a

DIOPT Version :10

Sequence 1:NP_572395.2 Gene:CheA7a / 31672 FlyBaseID:FBgn0029948 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_551661.4 Gene:CheA7a / 3290432 VectorBaseID:AGAMI1_009933 Length:178 Species:Anopheles gambiae


Alignment Length:61 Identity:15/61 - (24%)
Similarity:20/61 - (32%) Gaps:21/61 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PGVAPLAAP---------------------VLAAAPPVFAAPAPLMAPPAPVLASSPAFAA 78
            ||:||.||.                     .:.......:||..::...|||...||.|.|
Mosquito   486 PGLAPTAAAGGVNGNKRNNKNKQRSARKDVNVVNGGDADSAPTEVVDQAAPVARQSPVFVA 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA7aNP_572395.2 DM8 89..177 CDD:214778
CheA7aXP_551661.4 DUF1091 78..157 CDD:461928
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.