DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and dok6

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001082908.1 Gene:dok6 / 795289 ZFINID:ZDB-GENE-070410-50 Length:332 Species:Danio rerio


Alignment Length:272 Identity:62/272 - (22%)
Similarity:107/272 - (39%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLAGYLNVPTQTGFSLNRISKKKACSRYC-LLF-KASRHGIARLEMCESKE-------DRNPKIF 62
            |..||:.:.          |||....|.| |:| |||..|..|||....::       .:..::.
Zfish     9 VKQGYVRIR----------SKKLGIFRRCWLVFKKASSKGPRRLEKYPDEKAAYFRSFHKITELH 63

  Fly    63 TLENCVKITQEPPPERLIHIVKRQATLTLSTSSEEELKDW--ITALQTVAFCDTSPSGG------ 119
            .::|..::.:|.....:..|...:.:.|.:..||.|.::|  :..|:.:.......|.|      
Zfish    64 NIKNITRMPRETKKHAVAIIFCDETSKTFACESELEAEEWWKLLCLECLGSRLNDISLGEPDLLA 128

  Fly   120 IGAIEEDNDLYCSSFDGLFIITLIPS---EASIRCCIEPKTYMLQMTPTELQL-KSEDLGATIAM 180
            .|...|.|:        .|.:.|:|:   :....|       .:|:|...:.| ...:....:.|
Zfish   129 AGVQREQNE--------RFNVYLMPTPNLDIYGEC-------TMQITHENIYLWDIHNARVKLVM 178

  Fly   181 WPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNPQEVFR--------------CMSAKMKS 231
            ||...:|:||.....||||:||.|.||||:||......:.:::              .|..:|:.
Zfish   179 WPLNSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQRVHSATLSIAEQHERMMMEMEK 243

  Fly   232 MKKLISGDSLST 243
            ..:.:|.:|..|
Zfish   244 SSQTLSNESTLT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574 26/113 (23%)
PH 6..107 CDD:278594 25/110 (23%)
PH-like 138..232 CDD:302622 28/111 (25%)
dok6NP_001082908.1 PH_DOK4_DOK5_DOK6 9..113 CDD:270197 26/113 (23%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.