DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and DOK4

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001317485.1 Gene:DOK4 / 55715 HGNCID:19868 Length:365 Species:Homo sapiens


Alignment Length:403 Identity:96/403 - (23%)
Similarity:139/403 - (34%) Gaps:117/403 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLAGYLNVPTQTGFSLNRISKKKACSRYC-LLF-KASRHGIARLEMCESKEDRNPKIFTLENCVK 69
            |..||:.:.          |:|....|.| |:| |:|..|..|||....:     |...|..|.|
Human     9 VKQGYVKMK----------SRKLGIYRRCWLVFRKSSSKGPQRLEKYPDE-----KSVCLRGCPK 58

  Fly    70 ITQEPPPE---RLIHIVKRQATL---------TLSTSSEEELKDWITALQTVAFCDTSPSGGIGA 122
            :|:....:   ||....||||..         |.:..||.|.::|...|...  |..|....|..
Human    59 VTEISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVE--CLGSRLNDISL 121

  Fly   123 IEED---NDLYCSSFDGLFIITLIPSEASIRCCIEPKTY---MLQMTPTELQL-KSEDLGATIAM 180
            .|.|   ..:.|...| .|.:.|:|       |.....|   .||:|...:.| ...:....:..
Human   122 GEPDLLAPGVQCEQTD-RFNVFLLP-------CPNLDVYGECKLQITHENIYLWDIHNPRVKLVS 178

  Fly   181 WPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNPQEVF-RCMSAKM--------------K 230
            ||...:|:||....:|||||||.|..|||::|......:::: |..||.:              |
Human   179 WPLCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEK 243

  Fly   231 SMKKLISGDSLSTLECGE---------------NQFSAAAGMEPGSRSPLPPSPS-------SNP 273
            :::.|..|....:..|..               :|..|.|....|...|. |:|:       ..|
Human   244 NVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGESLPC-PTPTCQEALWRMRP 307

  Fly   274 HG-GEFEINSTQSCISL---RGF-----ISSNDSLNNFSAGGGGASGATATGGGVLGSTGGITLS 329
            .| |.|::..:....|:   .|:     .|..|.||.|                        .|.
Human   308 IGQGSFDLALSSEPASVPTGEGYGAAQASSETDLLNRF------------------------ILL 348

  Fly   330 VPANSNSNSSSSK 342
            .|..|..:||.:|
Human   349 KPKPSQGDSSEAK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574 32/116 (28%)
PH 6..107 CDD:278594 31/113 (27%)
PH-like 138..232 CDD:302622 30/112 (27%)
DOK4NP_001317485.1 PH_DOK4_DOK5_DOK6 9..113 CDD:270197 33/120 (28%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141613
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.