DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and Dok5

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_006235735.1 Gene:Dok5 / 502694 RGDID:1562846 Length:308 Species:Rattus norvegicus


Alignment Length:347 Identity:79/347 - (22%)
Similarity:126/347 - (36%) Gaps:80/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLAGYLNVPTQTGFSLNRISKKKACSRYCLLFKASRHGIARLEMCESKEDRNP------KIFTLE 65
            |..||:.:.::      |:...:.|  :.:..|||..|..|||  :..::|..      |:..|.
  Rat     9 VKQGYVRIRSR------RLGIYQRC--WLVFKKASSKGPKRLE--KFSDERAAYFRCYHKVTELN 63

  Fly    66 NCVKITQEPPPERLIHIV----KRQATLTLSTSSEEELKDWITALQTVAFCDTSPSGGIGAIEED 126
            | ||.....|.....|.:    ....:.|.:..|:.|..:|...||...         :|.  ..
  Rat    64 N-VKNVARLPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQIEC---------VGT--RI 116

  Fly   127 NDLYCSSFDGL-----------FIITLIPS---EASIRCCIEPKTYMLQMTPTELQL-KSEDLGA 176
            ||:.....|.|           |.:.|:||   :....|.       ||:|...:.| ..::...
  Rat   117 NDISLGEPDLLATGVEREQSERFNVYLMPSPNLDVHGECA-------LQITYEYICLWDIQNPRV 174

  Fly   177 TIAMWPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNPQEVFRCMSAKMKSMKKLISGDSL 241
            .:..||...:|:||.....|||||||.|.||||:|.....:.:.:::    |:.|....|:....
  Rat   175 KLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQ----KVHSAALAIAEQHE 235

  Fly   242 STLECGENQF------SAAAGMEPGSRSPLPPSPSSNPHGGEFEINSTQSCISLRGFISSNDSLN 300
            ..|:..:|..      ...|..|..|.:.|           .::..:|.||.:|  :..|.....
  Rat   236 RLLQSVKNSMVMMLDRQGPALEETASLTVL-----------TWKKETTTSCCTL--YEKSEVQTG 287

  Fly   301 NFSAGGGGASGATATGGGVLGS 322
            :|....||......   |:|||
  Rat   288 SFVCSNGGLMFLEP---GILGS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574 26/112 (23%)
PH 6..107 CDD:278594 24/109 (22%)
PH-like 138..232 CDD:302622 28/97 (29%)
Dok5XP_006235735.1 PH 8..111 CDD:278594 26/112 (23%)
PH_DOK4_DOK5_DOK6 9..113 CDD:270197 26/123 (21%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 30/112 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21258
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.