DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and CG13398

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster


Alignment Length:390 Identity:84/390 - (21%)
Similarity:142/390 - (36%) Gaps:104/390 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LQMTPTELQLKSEDLGATIAMWPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNPQEVFRC 224
            |::||.||..:|.  |....:|..:.:|:||..:..|:|||||:|.:|.|::|....|.::::  
  Fly    41 LELTPRELIFQSP--GCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLY-- 101

  Fly   225 MSAKMKSMKKLISGDSLSTLECGENQ-------FSAAAGMEPGSRSPLPPSPSSNPHGGEF--EI 280
                 ...::.|:..:......||.:       .|...|...|: :.|.|:|..:...|.|  |.
  Fly   102 -----PMFQRYINAVNTDAFVQGERERVNSAHSVSVNMGRTEGN-NYLEPAPLMSRQLGNFHSEP 160

  Fly   281 NSTQSCISLRGFISS-NDSLNNFSAGGGGASG-----ATATGGGVLGSTGGITLSVPANSNSNSS 339
            :||.:...|:...|. :||..|..:.....|.     ..|.....|..|....||.|.:.|..:|
  Fly   161 SSTSASYPLQANDSQVDDSPPNLQSPVLIPSAYLDQPLRALQDCCLEGTASDLLSTPPSGNRLTS 225

  Fly   340 SSKHI--------PNKPPRKSPTTHCDKYRN-----------------------------IVKYE 367
            ..:.:        |...|..||......|.|                             |...|
  Fly   226 RRRTMDLPPLESAPAPAPVLSPNDAVHMYANVEALIFDLNNERCYENVNRLELPLLPREPISNQE 290

  Fly   368 PVAITTIS-------------------SPSANSD-VNS-----SVILKPLEGESISLPE--TAAD 405
            |...|:::                   .|:.:|. :|.     |:|..|....:...||  |..|
  Fly   291 PATPTSLAGSCGVNYIVLDLDQPRSPVGPAGSSKAINGFGSGLSLISTPAAVTAPVTPEAGTTLD 355

  Fly   406 LPPDLPLRNESASKAPPPERDYECIENITEAWRTRGVGDVRHSERMPILCDTSEFVRQRSVSKST 470
            :||. |::.:|.:.......|.:. :.:||...|:|.             .|.:|:|..:::||:
  Fly   356 VPPP-PMQTQSLNSISADTGDTQA-KKVTECSGTQGY-------------STIDFIRTYALNKSS 405

  Fly   471  470
              Fly   406  405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574
PH 6..107 CDD:278594
PH-like 138..232 CDD:302622 22/71 (31%)
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439106
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21258
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5513
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.