DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and Dok1

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001020587.1 Gene:Dok1 / 312477 RGDID:1309499 Length:480 Species:Rattus norvegicus


Alignment Length:315 Identity:85/315 - (26%)
Similarity:132/315 - (41%) Gaps:74/315 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RISKKKACSRYCLLFKASRHGIARLEMCESKEDRNP-----------KIFTLENCVK---ITQEP 74
            |...|:....:.:|:.||.||:||||..:.|...:.           |:..|..||.   :|.|.
  Rat    16 RFGTKRWKKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGGSRRLDCKMIRLAECVSVVPVTVES 80

  Fly    75 PPE------RLIHIVKRQATLTLSTSSEEELKDWITALQTVAFCDTSPSGG-----------IGA 122
            |||      || ...:|...|....:|...   |:..|...||    |.||           ..|
  Rat    81 PPEPGASAFRL-DTAQRSHLLAADAASSTA---WVQILCRTAF----PKGGWALAQTENPPKFSA 137

  Fly   123 IEE-DNDLYCSSFDG-LFIITLIPSEASIRCCIEPKTYMLQMTPTELQLKSEDLGA------TIA 179
            :|. :|.||..:::| .|.:|...:|||.||.:: .:|:|::...:|.|.:  |||      .:.
  Rat   138 LEMLENSLYSPTWEGSQFWVTSQKTEASERCGLQ-GSYVLRVEAEKLTLLT--LGAQSQILEPLL 199

  Fly   180 MWPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNPQEVFRCMSAKMKSMK---KLISGDSL 241
            .|||..:|:||.....|:|||||:|.:|.|.||.......::|:.:.|.::..|   |:..|..:
  Rat   200 FWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVEAAIQQQKAQGKVGQGQDI 264

  Fly   242 STLECGENQFSAAAGMEPGSRSPL----------------PPSPS-----SNPHG 275
            :..:..:.:........|..:.||                ||.||     |:|.|
  Rat   265 TRTDSHDGETEGKMAPTPVPQEPLGSPPALYAEPLDSLRIPPGPSQDSLYSDPLG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574 28/105 (27%)
PH 6..107 CDD:278594 27/102 (26%)
PH-like 138..232 CDD:302622 33/99 (33%)
Dok1NP_001020587.1 PH-like 6..119 CDD:418428 28/106 (26%)
PTB_DOK1_DOK2_DOK3 151..253 CDD:269914 34/104 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..328 13/67 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335311
Domainoid 1 1.000 64 1.000 Domainoid score I9887
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46340
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21258
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1028
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.