DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and DOK6

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_689934.2 Gene:DOK6 / 220164 HGNCID:28301 Length:331 Species:Homo sapiens


Alignment Length:330 Identity:79/330 - (23%)
Similarity:127/330 - (38%) Gaps:81/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLAGYLNVPTQTGFSLNRISKKKACSRYC-LLF-KASRHGIARLEMCESKED---RN----PKIF 62
            |..||:.:.          |:|....|.| |:| |||..|..|||....::.   ||    .::.
Human     9 VKQGYVKIR----------SRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVTELH 63

  Fly    63 TLENCVKITQEPPPERLIHIVKRQATLTLSTSSEEELKDWI---------TALQTVAFCDTSPSG 118
            .::|..::.:|.....:..|...:.:.|.:..||.|.::|.         |.|..::..:.....
Human    64 NIKNITRLPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDISLGEPDLLA 128

  Fly   119 GIGAIEEDNDLYCSSFDGLFIITLIPS-------EASIRCCIEPKTYMLQMTPTELQLKSEDLGA 176
            . |...|.|:        .|.:.|:|:       |.:::...| ..|:..:...:::|       
Human   129 A-GVQREQNE--------RFNVYLMPTPNLDIYGECTMQITHE-NIYLWDIHNAKVKL------- 176

  Fly   177 TIAMWPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNPQEVFRCMSAKMKSMKKLISGDSL 241
              .|||...:|:||.....||||:||.|.||||:||......:.:::    |:.|          
Human   177 --VMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQ----KVHS---------- 225

  Fly   242 STLECGENQFSAAAGMEPGSR------SPLPPSPS-SNPHGGEF----EINSTQSCISLR--GFI 293
            :||...|........||..:|      .|:..|.| |.|....:    ..||.....||:  ||.
Human   226 ATLAIAEQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHGFG 290

  Fly   294 SSNDS 298
            ||..|
Human   291 SSKMS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574 28/120 (23%)
PH 6..107 CDD:278594 27/117 (23%)
PH-like 138..232 CDD:302622 27/100 (27%)
DOK6NP_689934.2 PH_DOK4_DOK5_DOK6 9..113 CDD:270197 26/113 (23%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 33/133 (25%)
DKFBH motif 263..273 1/9 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..331 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141619
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.