DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and DOK1

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001372.1 Gene:DOK1 / 1796 HGNCID:2990 Length:481 Species:Homo sapiens


Alignment Length:475 Identity:114/475 - (24%)
Similarity:178/475 - (37%) Gaps:133/475 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLAGYLNVPTQTGFSLNRISKKKACSRYCLLFKASRHGIARLEMCESKEDRNP-----------K 60
            |:.|.|.:.:|      |...|:....:.:|:.||.||:||||..:.|...:.           |
Human     5 VMEGPLFLQSQ------RFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCK 63

  Fly    61 IFTLENCVK---ITQEPPPE------RLIHIVKRQATLTLSTSSEEELKDWITAL---------Q 107
            :..|..||.   :|.|.|||      || ...:|...|.....|...   |:..|         .
Human    64 VIRLAECVSVAPVTVETPPEPGATAFRL-DTAQRSHLLAADAPSSAA---WVQTLCRNAFPKGSW 124

  Fly   108 TVAFCDTSPSGGIGAIEE-DNDLYCSSFDG-LFIITLIPSEASIRCCIEPKTYMLQMTPTELQLK 170
            |:|..|..|.  :.|:|. :|.||..:::| .|.:|:..:||:.||.:. .:|:|::....|.|.
Human   125 TLAPTDNPPK--LSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLH-GSYVLRVEAERLTLL 186

  Fly   171 SEDLGA------TIAMWPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNPQEVFRCMSA-- 227
            :  :||      .:..|||..:|:||.....|:|||||:|.:|.|.||.......::|:.:..  
Human   187 T--VGAQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAI 249

  Fly   228 -KMKSMKKLISGDSLSTLECGENQFSAAAGMEPGSRSPLPPSPSSNPHGGEFEINSTQSCI---- 287
             :.|:..|  :|.....|....::...|.|     :.|.||.|.        |:..:...:    
Human   250 HRQKAQGK--AGQGHDVLRADSHEGEVAEG-----KLPSPPGPQ--------ELLDSPPALYAEP 299

  Fly   288 --SLR-GFISSNDSLNNFSAGGGGASGATATGGGVLGSTGGITLSVPANSNSNSSSSKHIPNKPP 349
              ||| ....|.|||                            .|.|.:|.| :.:.:.:..|.|
Human   300 LDSLRIAPCPSQDSL----------------------------YSDPLDSTS-AQAGEGVQRKKP 335

  Fly   350 RKSPTTHCDKYRNIVKYEPVAITTISSPSANSDVNSSVILKPLEGESISLPETAADLPP----DL 410
                 .:.|.|.:                |...:..:.:..|.|......||..|.:||    ||
Human   336 -----LYWDLYEH----------------AQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDL 379

  Fly   411 PLRNESA--SKAPPPERDYE 428
            |...:.|  .:|...|..||
Human   380 PREPKDAWWCQARVKEEGYE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574 33/131 (25%)
PH 6..107 CDD:278594 32/128 (25%)
PH-like 138..232 CDD:302622 31/102 (30%)
DOK1NP_001372.1 PH-like 6..119 CDD:327399 31/122 (25%)
PTB_DOK1_DOK2_DOK3 151..253 CDD:269914 31/104 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..293 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..329 8/50 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 404..481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141621
Domainoid 1 1.000 64 1.000 Domainoid score I10117
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42191
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21258
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5513
SonicParanoid 1 1.000 - - X1028
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.