DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and Dok2

DIOPT Version :9

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_011243245.1 Gene:Dok2 / 13449 MGIID:1332623 Length:434 Species:Mus musculus


Alignment Length:432 Identity:110/432 - (25%)
Similarity:174/432 - (40%) Gaps:105/432 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLFKASRHGIARLEMCESKE-----DRNPKIFTLENCVKITQ-----EPPPERLIHIVKRQATLT 90
            :|:..|...:||||:.:..|     :...|:..|.:|:::.:     ..|.:....|::.:..|.
Mouse    54 VLYGESGCALARLELQDVPEKTRRGEATRKVVRLSDCLRVAEVGSEASSPRDTSAFILETKERLY 118

  Fly    91 LSTSSEEELKDWITALQTVAFCDTSPSGGIGAIE-------EDNDLYCSSFDGL---FIITLIPS 145
            |..:...|..|||.|:..:|| .....|..|..|       |:|:||.||..||   :::|:.|:
Mouse   119 LLAAPSAERSDWIQAICLLAF
-PGQRKGSPGLEEKSGSPCMEENELYSSSTTGLCKEYMVTIRPT 182

  Fly   146 EASIRCCIEPKTYMLQMTPTELQL-KSEDLGATIAMWPYRFIRKYGYRDGKFTFEAGRKCTTGEG 209
            |||.||.:. .:|.|:...:.|:| ...:.|..:..|||||:|::|.....|:|||||:|.:|||
Mouse   183 EASERCRLR-GSYTLRTGVSALELWGGPEPGTQLYDWPYRFLRRFGRDKATFSFEAGRRCLSGEG 246

  Fly   210 VFTLDHTNPQEVFRCMSAKMKSMKKLISGDSLSTLECGENQFSAAAGMEPGSRSPLPPSPSSNPH 274
            .|..:..:..|:|       ::::|:|:....:| ..|.....|...|.| :..|.|.||.|.||
Mouse   247 NFEFETRHGNEIF-------QALEKVIAVQKNAT-PSGPPSLPATGPMMP-TVLPRPESPYSRPH 302

  Fly   275 GGEFEINSTQSCISLRGFISSNDSLNNFSAGGGGASGATATGGGVLGSTGGITLSVPANSNSNS- 338
                                  |||.:.|.|       |...|...|:..| ..:||.::.::| 
Mouse   303 ----------------------DSLPSPSPG-------TLVPGMRPGAPEG-EYAVPFDTVAHSL 337

  Fly   339 -SSSKHIPNKPPRKSPTTHCDKYRNIVKYEPVAITTISSPSANSDVNSSVILKPLEGESISLPET 402
             .|.:.:...||...|             :|:..:....|.|           ||.......||.
Mouse   338 RKSFRGLLTGPPPHLP-------------DPLYDSIQEDPGA-----------PLPDHIYDEPEG 378

  Fly   403 AADLPPDLPLRNESASKAPPPERDYECIENITEAWRTRGVGD 444
            .|.|  .|..|.:..|               .|.||.:...|
Mouse   379 VAAL--SLYDRTQRPS---------------GETWREQATAD 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..110 CDD:214574 19/83 (23%)
PH 6..107 CDD:278594 19/80 (24%)
PH-like 138..232 CDD:302622 32/94 (34%)
Dok2XP_011243245.1 PH-like 43..139 CDD:388408 19/84 (23%)
PTB_DOK1_DOK2_DOK3 172..270 CDD:269914 34/105 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831562
Domainoid 1 1.000 64 1.000 Domainoid score I10083
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004741
OrthoInspector 1 1.000 - - otm44242
orthoMCL 1 0.900 - - OOG6_110776
Panther 1 1.100 - - O PTHR21258
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5513
SonicParanoid 1 1.000 - - X1028
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.