DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dok and LOC1279345

DIOPT Version :10

Sequence 1:NP_572391.1 Gene:Dok / 31667 FlyBaseID:FBgn0029944 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_061515377.1 Gene:LOC1279345 / 1279345 VectorBaseID:AGAMI1_012167 Length:739 Species:Anopheles gambiae


Alignment Length:72 Identity:20/72 - (27%)
Similarity:31/72 - (43%) Gaps:16/72 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 VCILLNKDS-CQVGYDLFFYCTWIGYMN---SFMN--PIIYTIFNTEFRRA--------FKSIIF 689
            :||..|..| ..:...||:|.|:....|   ||.|  |::..:.|.|:.::        .||:  
Mosquito   157 ICISYNTVSLATIAQQLFYYNTFTYQFNLPQSFANQFPVLSQLKNKEYNKSPPLTSTKVLKSL-- 219

  Fly   690 GRNSTRH 696
            |....||
Mosquito   220 GGQHFRH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DokNP_572391.1 PH 6..107 CDD:459697
IRS 138..233 CDD:460473
LOC1279345XP_061515377.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.