DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg5 and atg5

DIOPT Version :9

Sequence 1:NP_572390.1 Gene:Atg5 / 31666 FlyBaseID:FBgn0029943 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_596427.1 Gene:atg5 / 2540814 PomBaseID:SPBC4B4.10c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:270 Identity:64/270 - (23%)
Similarity:122/270 - (45%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MIWEGQIGICFQADRDEIVGIKPEPFYLM-ISRLSYLPLVTDKVRKYFSRYISAEHQDGAVWFDF 73
            ::|.|.|.:....:.:.:.       ||. :.|.||...:...|::..:..|....    .|.|:
pombe    13 LLWNGTISVRIDYEGNSLA-------YLANVPRQSYFAQILPNVQRLLAPSIPLSE----CWLDY 66

  Fly    74 NGTPLRLHYPIGVLYDLLHPEEDSTP-----WCLTIHFSKFPEDMLVKLNSKELLESHYMSCLKE 133
            ||.||:.|:|:|:|:|||...:..||     |.:.:....||...::::.:.:...:::.:||||
pombe    67 NGVPLKWHWPVGLLFDLLTVFDPDTPRAPVLWRIQLRSGLFPTTKILQMETMDTFRTYFFNCLKE 131

  Fly   134 ADVLKH---RGLVISAMQKKDHNQLWLGLVNEKFDQFWAVNRRLMEPYGDLESFKNIPLRIYTDD 195
            :|.:::   .|::  |:.|.:.:..|..::|..:..|..:..:::     ....|.|||:||...
pombe   132 SDYVRNGSSSGII--ALSKAETDTYWNAILNHDYYDFRPIAIKIL-----FSKSKFIPLKIYLGA 189

  Fly   196 DFTYTQKLISPI--SVGG-QKKSLADLMAE-----LSTPVRRAVGCRTHGIDLHEETQLQWMSEH 252
            :....| ..:|:  |:|. ..|.|.||...     :..||       .|||.:..::.|..::..
pombe   190 NAPIIQ-TSAPLGSSLGEFLNKRLPDLFPSCDKFLIVKPV-------IHGITIFLQSVLDELNRD 246

  Fly   253 LSYPDNFLHL 262
            ..|.|.|||:
pombe   247 FCYIDGFLHI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg5NP_572390.1 APG5 81..264 CDD:282025 48/198 (24%)
atg5NP_596427.1 APG5 73..259 CDD:282025 48/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3014
eggNOG 1 0.900 - - E1_KOG2976
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1833
OMA 1 1.010 - - QHG59300
OrthoFinder 1 1.000 - - FOG0004713
OrthoInspector 1 1.000 - - oto100502
orthoMCL 1 0.900 - - OOG6_103775
Panther 1 1.100 - - LDO PTHR13040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R110
SonicParanoid 1 1.000 - - X3313
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.