DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg5 and Atg5

DIOPT Version :9

Sequence 1:NP_572390.1 Gene:Atg5 / 31666 FlyBaseID:FBgn0029943 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_444299.1 Gene:Atg5 / 11793 MGIID:1277186 Length:275 Species:Mus musculus


Alignment Length:271 Identity:130/271 - (47%)
Similarity:181/271 - (66%) Gaps:9/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAHDREVLRMIWEGQIGICFQADRDEIVGIKPEPFYLMISRLSYLPLVTDKVRKYFSRYISAEHQ 65
            |..|::|||.:|.|:|..||...:|||...:.||:||::.|:|||.||||||:|:|.: :..:..
Mouse     1 MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQK-VMRQED 64

  Fly    66 DGAVWFDFNGTPLRLHYPIGVLYDLLHPEEDSTPWCLTIHFSKFPEDMLVKLNSKELLESHYMSC 130
            ...:||::.||||:.|||||:|:||| ....:.||.:|:||..|||..|:...||:.:|:|:|||
Mouse    65 VSEIWFEYEGTPLKWHYPIGLLFDLL-ASSSALPWNITVHFKSFPEKDLLHCPSKDAVEAHFMSC 128

  Fly   131 LKEADVLKHRGLVISAMQKKDHNQLWLGLVNEKFDQFWAVNRRLMEPYGDLESFKNIPLRIY-TD 194
            :||||.|||:..||:.||||||.|||:||.|::||||||:||:|||...:...|:.||.||| |.
Mouse   129 MKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPPEENGFRYIPFRIYQTT 193

  Fly   195 DDFTYTQKLISPISVGGQKKSLADLMAELSTPV------RRAVGCRTHGIDLHEETQLQWMSEHL 253
            .:..:.|||..|::..||..:|.||:.|:....      .:......|||:...||.|||:||||
Mouse   194 TERPFIQKLFRPVAADGQLHTLGDLLREVCPSAVAPEDGEKRSQVMIHGIEPMLETPLQWLSEHL 258

  Fly   254 SYPDNFLHLSV 264
            ||||||||:|:
Mouse   259 SYPDNFLHISI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg5NP_572390.1 APG5 81..264 CDD:282025 94/189 (50%)
Atg5NP_444299.1 APG5 79..270 CDD:367816 95/193 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843025
Domainoid 1 1.000 195 1.000 Domainoid score I3156
eggNOG 1 0.900 - - E1_KOG2976
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3566
Inparanoid 1 1.050 269 1.000 Inparanoid score I3011
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004713
OrthoInspector 1 1.000 - - oto92060
orthoMCL 1 0.900 - - OOG6_103775
Panther 1 1.100 - - LDO PTHR13040
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R110
SonicParanoid 1 1.000 - - X3313
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.