DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brk and Daxx

DIOPT Version :9

Sequence 1:NP_511069.3 Gene:brk / 31665 FlyBaseID:FBgn0024250 Length:704 Species:Drosophila melanogaster
Sequence 2:XP_006256165.1 Gene:Daxx / 140926 RGDID:621227 Length:738 Species:Rattus norvegicus


Alignment Length:298 Identity:72/298 - (24%)
Similarity:107/298 - (35%) Gaps:87/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 AYHHNLHGYLENRLEAVATPAPMDLSLGSSARRQMQL------HEKDP--SGVD-------LTFR 405
            |..|:| |....:|:.:|..|..|:.:....||.:.|      |..|.  .|||       |..|
  Rat   295 ATRHSL-GLPRQQLQLLAQDAFRDVGVRLQERRHLDLIYNFGCHLTDDYRPGVDPALTDPTLARR 358

  Fly   406 KRKVITSPMQPDKISKLEEVIKKEPETETENEDVE--------------VDVETEQPEEHKLPS- 455
            .|:..|..|     |:|:|||.|....:.::|:.|              .|:.....:..:.|| 
  Rat   359 LRENRTLAM-----SRLDEVISKYAMMQDKSEEGERQKRRARLLATSQSSDLPKASSDSGEGPSG 418

  Fly   456 --KQVKLFKPYLLDDDEEQDHHHHHHHHRQEDLDEGAAEEEQDDEEESRYADDDEVDSKEAADKK 518
              .|.....|....:|||.|.........:|:.:|.|.|:|.:|.|:.:...|||  .:|..|.:
  Rat   419 VASQEDPTTPKAETEDEEDDEESDDEEEEEEEEEEEATEDEDEDLEQLQEDQDDE--EEEEGDNE 481

  Fly   519 QRRLKKKPSAINEQREPIIWSNHPYPGGCVSPGSSITSSFQCPTSMQQQQTFPVAGGSPNQQFQD 583
            ..:....||.|..:|                 .|:.|...:.|   ::||...:.|         
  Rat   482 DDKSPTSPSPIFRRR-----------------NSAPTEGLRSP---EEQQERGLTG--------- 517

  Fly   584 NCSSSKATTPLSPFSAPALSPTGFCCPKGSPVSGYESS 621
                    ||.||..|   ||       |.|.:..|||
  Rat   518 --------TPASPLEA---SP-------GLPSTDAESS 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brkNP_511069.3 BrkDBD 43..100 CDD:286662
DaxxXP_006256165.1 Daxx 56..146 CDD:281355
DAXX_histone_binding 181..385 CDD:240523 27/95 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12766
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.